BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10d18 (624 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47500.1 68418.m05865 pectinesterase family protein contains ... 29 3.3 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 28 4.4 At1g73430.1 68414.m08500 sec34-like family protein contains Pfam... 28 4.4 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 4.4 At1g33170.1 68414.m04096 dehydration-responsive family protein s... 28 4.4 At1g42470.1 68414.m04897 patched family protein similar to SP|O1... 27 7.7 >At5g47500.1 68418.m05865 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 362 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 362 LNSNKESKHVQCVLKSIPKNVSRRLTFRSNEFFYNE 469 LN + + + VQ + SIPKN ++ +T + FY E Sbjct: 65 LNGHAQFRSVQDAVDSIPKNNNKSITIKIAPGFYRE 100 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +1 Query: 151 IIQILFKAKQNGRRLQNVDRRVSSHHQRETERISNQMVR*G 273 I ++L +A N R+ + + V++ + ETER+S++ V+ G Sbjct: 980 IQELLMEAGHNDRKEEEQNENVTAEVELETERVSSKKVQEG 1020 >At1g73430.1 68414.m08500 sec34-like family protein contains Pfam PF04136: Sec34-like family profile; similar to Conserved oligomeric Golgi complex component 3 (Vesicle docking protein SEC34 homolog) (p94) (Swiss-Prot:Q96JB2) [Homo sapiens] Length = 784 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/54 (27%), Positives = 33/54 (61%), Gaps = 3/54 (5%) Frame = +2 Query: 329 LSELIRIKIYGLNSNKESKHV---QCVLKSIPKNVSRRLTFRSNEFFYNEISFY 481 L ++++++ G S ++S+ + + L+ I +V+ RLTFR+ + +EI+ Y Sbjct: 417 LVHILKVEVLGDQSARQSEPLAGLRPTLQRILADVNERLTFRARTYIRDEIANY 470 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 353 IYGLNSNKESKHVQCVLKSIPKNVSRRLTFRSNEFFYNEI 472 +Y N+++ S+H LK+ K + R++ FRS+ Y ++ Sbjct: 3226 LYSGNNDESSEHTLSKLKTEHKRLQRKVIFRSDPKKYQDL 3265 >At1g33170.1 68414.m04096 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 639 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 449 NEFFYNEISFYEKVLPELS--KFRASKSANEPFDKCPKLLFSYVDGVHDVICLEDE 610 NE + IS+Y++++PELS +FR N + Y V +V+ ++ E Sbjct: 468 NEVWKERISYYKQIMPELSRGRFRNIMDMNAYLGGFAAAMMKYPSWVMNVVPVDAE 523 >At1g42470.1 68414.m04897 patched family protein similar to SP|O15118 Niemann-Pick C1 protein precursor from Homo sapiens (GB:AAB63982) (GI:2276463); contains Pfam profile PF02460 Patched family Length = 1272 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -3 Query: 346 ANQLAEVG--ITLAGVADILPMGEGCFLTEP 260 +N L EVG ITLA +A+IL G F+ P Sbjct: 699 SNALMEVGPSITLASLAEILAFAVGAFIKMP 729 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,086,060 Number of Sequences: 28952 Number of extensions: 232461 Number of successful extensions: 686 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -