BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10d17 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.8 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 3.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.1 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 435 ETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMS 551 +TLG N I EP+ + T K ++ A AP D++ Sbjct: 380 QTLGGSSNEIVEPVPQPVEEVTQKPSSTKAPAPPSRDLT 418 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 3.1 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = -2 Query: 403 ESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDRFCTSRAFRIGGRLSS 245 E++T CP K +V V++ + W T+ + D T+ +IG ++S+ Sbjct: 122 ENTTNCPEQKNTVTVTFTVQSDDTTLNWGTNESYNLD--LTTTGNQIGVQISA 172 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 20 PIFQTEQLISENVGGNKSSWKRHF 91 P +QT+ L+S + GG S+ F Sbjct: 188 PTYQTQGLLSPSYGGTTYSFTADF 211 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,588 Number of Sequences: 336 Number of extensions: 2930 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -