BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10d14 (420 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 3.7 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 20 8.5 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 3.7 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -2 Query: 236 VSPRPGLGDPHAPIPPLVPCNRPGTTRHSCLSPRCPSSWSPH*PSIRC 93 +SP P + +P I P + PG T + + + P++ P+I C Sbjct: 278 LSPPPHVYNPPDHIQQATPYSAPGPTYSTWSTVQTPTTVMS--PTINC 323 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 20.2 bits (40), Expect = 8.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 229 GETTEKDIHGMVQQSPQKSWHRHRE 303 GE +KDI +Q K +H+E Sbjct: 56 GEELKKDIPDALQNECAKCNEKHKE 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,741 Number of Sequences: 336 Number of extensions: 1676 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -