BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10d12 (572 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 3.1 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 24 4.0 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 24.2 bits (50), Expect = 3.1 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +1 Query: 181 YFTSNDGAFKIFAKQNEVISGKGQIVECSSAYLREIDKFEGCFPKQCKRF 330 Y + DGA ++ E G ++ EC ++R +P +CK F Sbjct: 394 YLHTLDGALELVRALVEPAGGSIELEECERIFVR----LYADYPAECKEF 439 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 265 SSAYLREIDKFEGCFPKQ 318 SS + R +DKFE C K+ Sbjct: 285 SSKFTRRVDKFEKCVVKR 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,574 Number of Sequences: 2352 Number of extensions: 10237 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -