BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10d11 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 3.0 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 4.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 4.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 4.0 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 6.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 9.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 9.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 9.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 9.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 9.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 9.2 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 511 INIGSQYNYGNDEHAEFLCVVSRE 582 +N Q+ G++ AEF+C+ + E Sbjct: 177 VNDVVQHQSGSEAEAEFVCIATPE 200 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/59 (18%), Positives = 25/59 (42%) Frame = +1 Query: 391 RERRPLKDSKKHVYRVLQFHEEELTQMVSTMSDGWKFEQLINIGSQYNYGNDEHAEFLC 567 RER + YR + +E ++ + + + ++ + YNY N+ + + C Sbjct: 43 REREQNSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNYKKLYC 101 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/59 (18%), Positives = 25/59 (42%) Frame = +1 Query: 391 RERRPLKDSKKHVYRVLQFHEEELTQMVSTMSDGWKFEQLINIGSQYNYGNDEHAEFLC 567 RER + YR + +E ++ + + + ++ + YNY N+ + + C Sbjct: 43 REREQNSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNYKKLYC 101 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/59 (18%), Positives = 25/59 (42%) Frame = +1 Query: 391 RERRPLKDSKKHVYRVLQFHEEELTQMVSTMSDGWKFEQLINIGSQYNYGNDEHAEFLC 567 RER + YR + +E ++ + + + ++ + YNY N+ + + C Sbjct: 43 REREQNSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNYKKLYC 101 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 337 EFYNITELIRLVKERICLRERRPLKDSKKH 426 +FY I+ I +RI L R P+K+ K+ Sbjct: 10 KFYRISPQILKNDKRIYLSPRTPIKNVYKN 39 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 219 RYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLE 253 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 219 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 253 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 230 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 264 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 230 RYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLE 264 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 219 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 253 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 230 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 264 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 230 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 264 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 219 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 253 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 219 RYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLE 253 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 364 RLVKERICLRERRPLKDSKKHVYRVLQFHEEELTQ 468 R +ER C R+R K Y L +E+L + Sbjct: 230 RYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLE 264 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,934 Number of Sequences: 438 Number of extensions: 3558 Number of successful extensions: 23 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -