BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c22 (648 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF024498-7|AAF39806.2| 279|Caenorhabditis elegans Serpentine re... 31 0.93 AC084154-12|AAK29876.1| 1137|Caenorhabditis elegans Hypothetical... 30 1.6 Z98877-12|CAB63409.1| 528|Caenorhabditis elegans Hypothetical p... 27 8.7 >AF024498-7|AAF39806.2| 279|Caenorhabditis elegans Serpentine receptor, class x protein104 protein. Length = 279 Score = 30.7 bits (66), Expect = 0.93 Identities = 11/50 (22%), Positives = 27/50 (54%) Frame = +2 Query: 401 GGFKHCISTCLDVILKYLPKAGPVICGAVERDVNREKAFLFVKNCGGDWI 550 G F + ++ + + L + K+ ++ + N+ + +LF+++C DWI Sbjct: 180 GVFTNVLNVSIAIKLYLISKSSNLLSSRASKTRNKNRVYLFLQSCFQDWI 229 >AC084154-12|AAK29876.1| 1137|Caenorhabditis elegans Hypothetical protein Y22D7AR.12 protein. Length = 1137 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 588 VQQNSLPAEKLVGIQSPPQFFTNKKAFSLLTSRSTAPQITGPALGRYFKI 439 ++Q S E +GI++ + SL T S P I GP +G+ KI Sbjct: 300 LEQYSRLVENSLGIETSEMIKETLRIHSLATKLSNLPSIVGPLVGKIDKI 349 >Z98877-12|CAB63409.1| 528|Caenorhabditis elegans Hypothetical protein Y69H2.12 protein. Length = 528 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 225 NPPKNSTKSTMMSSRVSVGCSCPSKWASKKVDAVD 329 NP +NS TM+ + C+C W ++ + D Sbjct: 169 NPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVAD 203 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,309,849 Number of Sequences: 27780 Number of extensions: 246790 Number of successful extensions: 596 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -