BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c20 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 2.7 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 6.1 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 6.1 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 8.1 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 2.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -1 Query: 217 LTLQTETHYCFTAEIGRVVVPTRADSQEVLPPVVKPLRLAS 95 L Q ET C+T+ ++ QEV P VK R +S Sbjct: 1176 LVNQNETLSCYTSRRNSTTSNANSEPQEVAPQFVKFARDSS 1216 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.4 bits (48), Expect = 6.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 176 NRQGGGTYPRGLTRGPTTSSKTSS 105 N GGG P G TTS TS+ Sbjct: 582 NHAGGGAIPEGQEPTSTTSLTTSA 605 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 6.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 196 HYCFTAEIGRVVVPTRADSQEVLP 125 H F AEIG +V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 269 AFTLRMSMGSSNHLTPG 319 AFTL + +GSS H + G Sbjct: 89 AFTLTVRLGSSRHASSG 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,626 Number of Sequences: 2352 Number of extensions: 10604 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -