BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c20 (637 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U38254-1|AAC50283.1| 638|Homo sapiens amiloride sensitive sodiu... 31 2.6 DQ898176-1|ABI64069.1| 704|Homo sapiens sodium channel nonvolta... 31 2.6 DQ898175-1|ABI64068.1| 638|Homo sapiens sodium channel nonvolta... 31 2.6 BC125075-1|AAI25076.1| 378|Homo sapiens SCNN1D protein protein. 31 2.6 BC125074-1|AAI25075.1| 638|Homo sapiens sodium channel, nonvolt... 31 2.6 AL162741-20|CAI23262.1| 638|Homo sapiens sodium channel, nonvol... 31 2.6 AL162741-19|CAI23261.1| 704|Homo sapiens sodium channel, nonvol... 31 2.6 AK131558-1|BAD18692.1| 669|Homo sapiens protein ( Homo sapiens ... 31 2.6 AK093239-1|BAC04105.1| 704|Homo sapiens protein ( Homo sapiens ... 31 2.6 >U38254-1|AAC50283.1| 638|Homo sapiens amiloride sensitive sodium channel delta subunit protein. Length = 638 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 175 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 225 >DQ898176-1|ABI64069.1| 704|Homo sapiens sodium channel nonvoltage-gated 1 delta protein. Length = 704 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 241 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 291 >DQ898175-1|ABI64068.1| 638|Homo sapiens sodium channel nonvoltage-gated 1 delta protein. Length = 638 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 175 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 225 >BC125075-1|AAI25076.1| 378|Homo sapiens SCNN1D protein protein. Length = 378 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 175 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 225 >BC125074-1|AAI25075.1| 638|Homo sapiens sodium channel, nonvoltage-gated 1, delta protein. Length = 638 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 175 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 225 >AL162741-20|CAI23262.1| 638|Homo sapiens sodium channel, nonvoltage-gated 1, delta protein. Length = 638 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 175 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 225 >AL162741-19|CAI23261.1| 704|Homo sapiens sodium channel, nonvoltage-gated 1, delta protein. Length = 704 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 241 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 291 >AK131558-1|BAD18692.1| 669|Homo sapiens protein ( Homo sapiens cDNA FLJ16802 fis, clone TESTI4005158, highly similar to Amiloride-sensitive sodium channel delta-subunit. ). Length = 669 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 206 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 256 >AK093239-1|BAC04105.1| 704|Homo sapiens protein ( Homo sapiens cDNA FLJ35920 fis, clone TESTI2010591, highly similar to AMILORIDE-SENSITIVE SODIUM CHANNEL DELTA-SUBUNIT. ). Length = 704 Score = 31.5 bits (68), Expect = 2.6 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -3 Query: 284 SAT*MRHPP*EVLRSQV*LQRLPHPSNRNALLLHGRNRQGGGTYPRGLTRG 132 SAT RH P L ++ LQRL H +R + N GG + RG T G Sbjct: 241 SATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSG 291 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,321,078 Number of Sequences: 237096 Number of extensions: 1576238 Number of successful extensions: 4478 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4478 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6972732040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -