BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c19 (379 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8) 29 1.3 SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) 27 6.7 SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) 26 8.8 SB_20418| Best HMM Match : Dynein_heavy (HMM E-Value=0) 26 8.8 >SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8) Length = 180 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 182 EIRPRCLHDFTVTSQRNYRETERCHTN 102 +I +C FT+T++ NYR + HTN Sbjct: 64 DICGKCFSRFTITTKYNYRHNYKHHTN 90 >SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) Length = 635 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 274 KIYISCFVRKPNSSSGNTF 218 +I SCF RKP+ SSG F Sbjct: 578 RIVGSCFSRKPSGSSGRAF 596 >SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 2532 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 319 YCIHRHGANKLIYQTKIYISCFVRKPNSSSGNTFKLH 209 YCI ++G NK +Y+ P +++ + F LH Sbjct: 2187 YCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLH 2223 >SB_20418| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 670 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 319 YCIHRHGANKLIYQTKIYISCFVRKPNSSSGNTFKLH 209 YCI ++G NK +Y+ P +++ + F LH Sbjct: 147 YCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLH 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,423,994 Number of Sequences: 59808 Number of extensions: 200656 Number of successful extensions: 332 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -