BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c19 (379 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2300|AAF48549.2| 418|Drosophila melanogaster CG12697-P... 43 1e-04 AE014296-1809|AAF50163.2| 404|Drosophila melanogaster CG14156-P... 31 0.65 U28136-1|AAA68953.1| 2146|Drosophila melanogaster insulin recept... 27 8.0 U18351-1|AAC47458.1| 2148|Drosophila melanogaster insulin recept... 27 8.0 AE014297-3020|AAF55903.2| 2144|Drosophila melanogaster CG18402-P... 27 8.0 >AE014298-2300|AAF48549.2| 418|Drosophila melanogaster CG12697-PA protein. Length = 418 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/38 (50%), Positives = 28/38 (73%) Frame = +3 Query: 90 SQKGVSVTTFGFSVISLASYSKIMKTAWSYFTLLLNIY 203 SQ+ V +T F FS +SL S++ I+ T+ SYFTLL ++Y Sbjct: 373 SQQPVRITAFKFSTLSLQSFTAILSTSISYFTLLRSVY 410 >AE014296-1809|AAF50163.2| 404|Drosophila melanogaster CG14156-PA protein. Length = 404 Score = 30.7 bits (66), Expect = 0.65 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 90 SQKGVSVTTFGFSVISLASYSKIMKTAWSYFTLLLNIYN 206 SQK S+ F ISL +Y K++ ++ +F LL Y+ Sbjct: 364 SQKPASIRPPTFPPISLVTYMKVISMSYQFFALLRTTYS 402 >U28136-1|AAA68953.1| 2146|Drosophila melanogaster insulin receptor homolog protein. Length = 2146 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 321 CTVYIGTEPTN*SIKLKSTFHV 256 CT+ GTEP SIK +S HV Sbjct: 664 CTIITGTEPLTISIKRESGAHV 685 >U18351-1|AAC47458.1| 2148|Drosophila melanogaster insulin receptor protein. Length = 2148 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 321 CTVYIGTEPTN*SIKLKSTFHV 256 CT+ GTEP SIK +S HV Sbjct: 668 CTIITGTEPLTISIKRESGAHV 689 >AE014297-3020|AAF55903.2| 2144|Drosophila melanogaster CG18402-PA protein. Length = 2144 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 321 CTVYIGTEPTN*SIKLKSTFHV 256 CT+ GTEP SIK +S HV Sbjct: 664 CTIITGTEPLTISIKRESGAHV 685 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,346,543 Number of Sequences: 53049 Number of extensions: 297405 Number of successful extensions: 507 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1003372560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -