Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10c14
         (542 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    28   0.071
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    21   8.1  

>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 27.9 bits (59), Expect = 0.071
 Identities = 15/47 (31%), Positives = 23/47 (48%)
 Frame = +1

Query: 151 YFRDKRSQYGTYYTSPCGGASSAPIPTYPSAGYHGQAPAQAGYGTNY 291
           +F D  +   +   S  GG SS+P P+ PS+ +   +P   G   NY
Sbjct: 68  WFNDSAAAITSTSPSYPGGGSSSPSPSSPSSFFSSVSPTSLG-SENY 113


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 21.0 bits (42), Expect = 8.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 391 AAYVACIGPYPNI 353
           A Y+ C  PYP+I
Sbjct: 214 AFYICCEEPYPDI 226


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,275
Number of Sequences: 438
Number of extensions: 3651
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15459066
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)