BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c10 (623 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 25 0.39 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.6 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 4.8 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 4.8 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 257 FIINYITCCLYSLRHSHIVTDKASICLFGWILH 159 F +N CL+ ++HSH TDK + W ++ Sbjct: 5 FWVNLALFCLH-VQHSHGATDKVICYVASWAIY 36 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 3.6 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 456 TLDQHYFPSADDFPHGMPN-NSPPRNIKTYRSQGDGARTT 572 T D +++ HG+ + + Y S GDG RTT Sbjct: 1151 TKDTKITAASETILHGLKKYTNYSMEVLAYTSGGDGVRTT 1190 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/17 (58%), Positives = 12/17 (70%), Gaps = 2/17 (11%) Frame = +3 Query: 450 IITLDQHYFP--SADDF 494 I+TL HYFP SA D+ Sbjct: 342 IVTLSAHYFPVFSACDY 358 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/17 (58%), Positives = 12/17 (70%), Gaps = 2/17 (11%) Frame = +3 Query: 450 IITLDQHYFP--SADDF 494 I+TL HYFP SA D+ Sbjct: 268 IVTLSTHYFPVFSACDY 284 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,877 Number of Sequences: 336 Number of extensions: 4104 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -