BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c08 (607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1682.10 |rpn8||19S proteasome regulatory subunit Rpn8|Schizo... 36 0.005 SPCC1494.04c |tyr1||prephenate dehydrogenase [NADP+] |Schizosacc... 27 1.6 SPBC691.05c ||SPBP22H7.01c|membrane transporter |Schizosaccharom... 26 3.7 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 25 6.5 SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 25 6.5 SPBC119.08 |pmk1|spm1|MAP kinase Pmk1 |Schizosaccharomyces pombe... 25 8.6 >SPCC1682.10 |rpn8||19S proteasome regulatory subunit Rpn8|Schizosaccharomyces pombe|chr 3|||Manual Length = 324 Score = 35.9 bits (79), Expect = 0.005 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Frame = +2 Query: 380 LHPLVIMNVSEHWTRLKAQEGFPQTVVGALIGKQKGRNIEVMNSFELVFSMXXXXXXXXX 559 +HPLV+++ + + R + +G + VVG L+G+ G + V NS+ + F Sbjct: 19 VHPLVLLSAVDSYNR--SAKGTKRRVVGILLGQNNGDVVNVANSYAIPFEEDEKNASVWF 76 Query: 560 XYYNMKE---EQFKQV 598 +N E E FK++ Sbjct: 77 LDHNFMESMNEMFKKI 92 >SPCC1494.04c |tyr1||prephenate dehydrogenase [NADP+] |Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 27.5 bits (58), Expect = 1.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 407 SEHWTRLKAQEGFPQTVVGALIGKQKGRNIEVMNSFE 517 +EH ++ A G P T VGA++G Q MN+FE Sbjct: 73 AEHIDKVVALYG-PATKVGAIVGGQTSCKAPEMNAFE 108 >SPBC691.05c ||SPBP22H7.01c|membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 668 Score = 26.2 bits (55), Expect = 3.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 256 YFHFHFEINSIST*HFNSGIRELNELKLEDYIMRNKYLYCL 134 YF H+ N +S F+ G + KL +RN+Y+Y L Sbjct: 393 YFVPHYIQNRMSQSFFSVGYIAKSTFKLNPLRLRNQYIYFL 433 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 25.4 bits (53), Expect = 6.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 242 MEVEVESASSGPPIEVPNPTSPAPTTPGSN 331 +E + S PP+ PTSP P P S+ Sbjct: 1344 LENQFSKMSLEPPVRPAVPTSPKPQIPDSS 1373 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 25.4 bits (53), Expect = 6.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 218 SADRIDFEMEVEVESASSGPPIEVPNPTSPAPTTP 322 ++ + DFE++ + + SG P N T+P +TP Sbjct: 57 ASHKYDFEIDRDSLKSDSGSPRLHQNATAPTSSTP 91 >SPBC119.08 |pmk1|spm1|MAP kinase Pmk1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 422 Score = 25.0 bits (52), Expect = 8.6 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = +2 Query: 176 FQFIEFSYPRVKMSSADRIDFEMEVEVESASSGPPIEVPNPTSPAPT 316 F++IE + ++ + ++F +V S + P + +P P P+ Sbjct: 334 FEYIEDANELRRVILDEVLNFRQKVRRRSHPTNPTVNIPQPAQTVPS 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,130,588 Number of Sequences: 5004 Number of extensions: 38943 Number of successful extensions: 88 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -