BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c08 (607 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 9.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 9.4 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 133 DYRNQFVGICNLIFMI*Q*YFPLYTLVIIICRG 35 D N FVG N +F + + Y L+ C G Sbjct: 1604 DSTNDFVGPKNCLFRKPEHFVASYALISNQCEG 1636 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +2 Query: 179 QFIEFSYPRVKMSS 220 ++++FSYPR++ S Sbjct: 105 EYLKFSYPRMRAPS 118 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 25 KLPYRDK*LSPKCREENIIVKS*ILNCK 108 ++PY K P+C N S + NC+ Sbjct: 144 QVPYTVKNFHPRCAVNNYNDPSNVRNCE 171 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,708 Number of Sequences: 438 Number of extensions: 3098 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -