BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c04 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.5 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 9.9 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 126 SDCDNINKTFCDHFVICDLKGKSN 55 S C N N T C+ F +L G S+ Sbjct: 709 SKCHNRNVTTCNMFRKTNLSGDSS 732 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 409 GWASLRRARRADPAASVAPLLAIQLSHPGSYSG 507 G+AS DP + + + +LS PGS +G Sbjct: 131 GYASPMSTSSYDPYSPNSKIGRDELSQPGSLNG 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,817 Number of Sequences: 438 Number of extensions: 3157 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -