BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c03 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 29 0.13 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 27 0.50 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 27 0.50 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 25 1.5 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 24 4.7 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 24 4.7 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 24 4.7 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 6.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 8.2 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 23 8.2 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 23 8.2 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 29.1 bits (62), Expect = 0.13 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +3 Query: 288 TSKSKLSADAKEWYPANYT--SQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDM 461 TS+ S +YP++ SQ +PA P +PSRP++ +Q + P D Sbjct: 355 TSRPVASGPTSHYYPSHIPAGSQPVPAVVN---PQQPSRPTIPAPQQQTPPRQPPATGDR 411 Query: 462 SYSLEEAENMD 494 + + + E +D Sbjct: 412 APAHPDVEQID 422 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 27.1 bits (57), Expect = 0.50 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +3 Query: 297 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNP 443 S+L D + Y P NT Y+ PSV G D NP Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 27.1 bits (57), Expect = 0.50 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +3 Query: 297 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNP 443 S+L D + Y P NT Y+ PSV G D NP Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 25.4 bits (53), Expect = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 336 NYTSQALPAYNTEPAPYRPSRPSVQGRL 419 NY PA EP +RP R QGRL Sbjct: 126 NYDLSMSPALWDEPERFRPERFLQQGRL 153 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 357 PAYNTEPAPYRPSRPSVQGRLRQAQDQNP 443 PAY +P Y P R + +L A P Sbjct: 191 PAYYPQPDVYNPDRFAASSKLSGASKNRP 219 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 363 YNTEPAPYRPSRPSVQGR 416 YN PY P+ PS GR Sbjct: 199 YNPNARPYNPNDPSFGGR 216 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 252 AGARVPGCSFATPGLVLL 199 AG R P C + P LVL+ Sbjct: 88 AGLRQPACRYRVPSLVLV 105 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 6.2 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 498 RENIANLITVMCEITFDPGKFDTLCGPLVDSFASTLN 608 R + N + + DPG D L GP+ +F L+ Sbjct: 103 RGELNNPFVALGDFLIDPGVSDPLFGPIFAAFLFQLS 139 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/62 (20%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +3 Query: 51 VYVSILANEIHAYENKYIYQSRLWNCIKAAL*--NCCRGLIVKMNNGDISAPKGRGRGWQ 224 V V+ L + A +Y+ + ++C + + C G + +G++ P + R W Sbjct: 989 VLVTCLLQFMFAVIGVQLYKGKFFSCSDGSKMQESECHGTYLVYEDGNVDKPVSKERYWS 1048 Query: 225 MN 230 N Sbjct: 1049 RN 1050 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 128 YQSCIVKLLPWT 163 YQ CIVK+ WT Sbjct: 173 YQKCIVKIGSWT 184 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +3 Query: 63 ILANEIHAYENKYIYQSRLWNCIKAAL*NCCR 158 + NE H IY LW +K + +CC+ Sbjct: 3 LYCNEFHFLFMYNIYYRALWLFLKFEVPHCCQ 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,425 Number of Sequences: 2352 Number of extensions: 15018 Number of successful extensions: 35 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -