BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10c02 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 325 3e-89 SB_54594| Best HMM Match : Ank (HMM E-Value=4.4e-11) 32 0.41 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.41 SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) 30 1.7 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.9 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 3.8 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 3.8 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 3.8 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 3.8 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 29 5.0 SB_22198| Best HMM Match : Borrelia_orfA (HMM E-Value=5.4) 29 5.0 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 6.7 SB_24946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 6.7 SB_51875| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) 28 8.8 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 28 8.8 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 325 bits (798), Expect = 3e-89 Identities = 152/169 (89%), Positives = 160/169 (94%) Frame = +2 Query: 215 WVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAG 394 WVPVTKLGRLV++ KI LE IYLFSLPIKEFEIIDFFLG +L DEVLKIMPVQKQTRAG Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAG 67 Query: 395 QRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKIGKPHT 574 QRTRFKAFVAIGD+NGH+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKIGKPHT Sbjct: 68 QRTRFKAFVAIGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Query: 575 VPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQDCYTSARG 721 VPCKVTGKCGS VRLIPAPRGTGIVSAPVPKKLLQMAG++DCYTS RG Sbjct: 128 VPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRG 176 >SB_54594| Best HMM Match : Ank (HMM E-Value=4.4e-11) Length = 733 Score = 32.3 bits (70), Expect = 0.41 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +2 Query: 425 IGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLP-VRRGYWGNKIGKPHTVPCKVTGKC 601 IGD+ G + V+ +K + G++ L+ P +RRG G++ KPH+ P ++ + Sbjct: 137 IGDSGGIDTMDVR-NKATGSVAWGSVTKRPLTSTPDIRRGQTGSEFRKPHSEPRFMSARF 195 Query: 602 GS 607 GS Sbjct: 196 GS 197 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 32.3 bits (70), Expect = 0.41 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 517 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 338 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 337 RAEEEI 320 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 32.3 bits (70), Expect = 0.41 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 517 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 338 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 337 RAEEEI 320 R ++E+ Sbjct: 577 RNQDEL 582 >SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) Length = 382 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 Query: 239 GRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYLH 129 G +W + L LP H DHDR H RH +H Sbjct: 103 GFLWQKNGVLLSLPPPQFRHSHDHDRHHYHRHHNNIH 139 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.9 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 490 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 359 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 344 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 457 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 344 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 457 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 344 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 457 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 344 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 457 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 344 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 457 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 344 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 457 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +2 Query: 524 LPVRRGYWGNKIG--KPHTVPCKVTGKCGSVTVRLIPAPRGT 643 LP GYW N G P PC V C + + P P GT Sbjct: 3355 LPCPAGYWCNIKGLADPSISPCPVGHYCLNAIDKPTPCPNGT 3396 >SB_22198| Best HMM Match : Borrelia_orfA (HMM E-Value=5.4) Length = 394 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -1 Query: 700 ILYTSHLKKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLSYLV 551 +LYT + + RN++ +NT T R Q + TT+ L D LS LV Sbjct: 36 LLYTRNSTRTARNYQYYNTRQTLCR-QRETINTTIHAKLYTDSEKLSILV 84 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -1 Query: 700 ILYTSHLKKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLSYLV 551 +LYT + + RN++ +NT T R Q + TT+ L D LS LV Sbjct: 285 LLYTRNSTRTARNYQYYNTRQTLCR-QRETINTTIHAKLYTDSEKLSILV 333 Score = 28.3 bits (60), Expect = 6.7 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -1 Query: 721 TTS*RVAI-LYTSHLKKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLSYLV 551 T S +++I LYT + + RN++ +NT T R Q + TT+ L D LS LV Sbjct: 136 TDSEKLSIPLYTRNSTRTARNYQYYNTRETLCR-QRETINTTIHAKLYTDSEKLSILV 192 Score = 27.9 bits (59), Expect = 8.8 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -1 Query: 721 TTS*RVAIL-YTSHLKKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLSYLV 551 T S +++IL YT + + RN++ +NT T R Q + TT+ L D LS L+ Sbjct: 183 TDSEKLSILVYTRNSTQTARNYQYYNTRKTL-RRQRETINTTIHAKLYTDSEKLSILL 239 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 6.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 394 TAHTFQGICCHWRQQRSYW 450 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_24946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 518 SVLPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSA 658 +V RG+W + + H + C V +CG + L AP +VS+ Sbjct: 303 TVFTTYRGFWNYALVRKHWLKCVVNLQCG-IAKHLSQAPSNKLLVSS 348 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 392 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 481 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_51875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = -2 Query: 702 QSCTPAI*RSFLGTGADTIPVPRGAGISRTVTEPHLPVTLQGTVCGFP 559 +SC PA + G G D G + TEPH QG P Sbjct: 144 RSCGPAFGDPWFGCGRDLFIADNAGGNKASCTEPHKYARPQGATSDGP 191 >SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) Length = 174 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 210 KSGFLSPNSAVLFAKEKSTNSRAFTCFLYQSKNSRSL 320 KSG L ++F E +S+AF C LY +KN SL Sbjct: 56 KSGRLGGMPNIVFNSEYQWSSKAFLCTLY-NKNGYSL 91 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -2 Query: 519 DSLARIIAPRMAVATSLLHFTPKPI*PLLSPMATNALKRVRCPA 388 D+L+ IAP A SLL + P+++P A +AL ++ P+ Sbjct: 365 DALSLQIAPSANNALSLLKGAYDALSPMIAPSANDALSLLKAPS 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,223,134 Number of Sequences: 59808 Number of extensions: 502798 Number of successful extensions: 1424 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1422 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -