BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b21 (466 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) 117 6e-27 SB_47982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_38972| Best HMM Match : PIP5K (HMM E-Value=0) 28 3.3 SB_13108| Best HMM Match : PRRSV_2b (HMM E-Value=6.1) 28 3.3 SB_19686| Best HMM Match : SCAN (HMM E-Value=3.2) 27 5.8 SB_29128| Best HMM Match : Ank (HMM E-Value=2.9e-19) 27 5.8 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_4336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_9162| Best HMM Match : Ribosomal_L19e (HMM E-Value=3.4) 27 7.7 SB_5012| Best HMM Match : 7tm_3 (HMM E-Value=0) 27 7.7 >SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) Length = 131 Score = 117 bits (281), Expect = 6e-27 Identities = 65/120 (54%), Positives = 76/120 (63%) Frame = +3 Query: 75 KVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYH 254 KVK ELR K + LRVAKVTGG ASKLSKI+VVRK++ARV V Sbjct: 11 KVKAHELRGKKKDELLKQLDELKTELSQLRVAKVTGGAASKLSKIKVVRKSVARVLTVVS 70 Query: 255 QKMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVK 434 Q + NLR Y+ KKY PLDLR K TRAMR++LTK EA KT K+ +K + F R YAVK Sbjct: 71 QTQRDNLRKFYRKKKYLPLDLRPKLTRAMRRSLTKKEASSKTLKQQKKLAHFSLRKYAVK 130 >SB_47982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 31.1 bits (67), Expect = 0.47 Identities = 22/57 (38%), Positives = 31/57 (54%) Frame = +3 Query: 189 ASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTK 359 ASK SK RV R IA++ H ++ +RN N K +R K+RAM+K T+ Sbjct: 588 ASKKSKKRVGRPDIAQLMRAKHFGIQTEVRN--LNSKCLIFGVRKFKSRAMKKMQTR 642 >SB_38972| Best HMM Match : PIP5K (HMM E-Value=0) Length = 426 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 222 KAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTR 335 KA ++V + H K NL +H+K K+Y P+ R + R Sbjct: 70 KAYSKVRVDNHLFNKENLPSHFKFKEYCPMVFRNLRER 107 >SB_13108| Best HMM Match : PRRSV_2b (HMM E-Value=6.1) Length = 311 Score = 28.3 bits (60), Expect = 3.3 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 288 KNKKYKPLDLRAKKTR-AMRKALTKHEAKIKTRKEIRKKSLFPPRVYA 428 +N+K DL K T +M + KH AK+ R E++ S PP V A Sbjct: 104 ENEKLWLSDLVEKSTPCSMDNSRQKHIAKLLLRSEMKGNSELPPHVQA 151 >SB_19686| Best HMM Match : SCAN (HMM E-Value=3.2) Length = 609 Score = 27.5 bits (58), Expect = 5.8 Identities = 32/135 (23%), Positives = 54/135 (40%), Gaps = 5/135 (3%) Frame = +3 Query: 21 YGILFKVRFEENVTVKM-GKVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASK 197 YGI + +EN K GK+K +T D ++ + G S Sbjct: 148 YGITEFRKNQENAKSKREGKIKVHRTKT-DPQTFLPSPENGTVLLPGIKSTRADGYGTSD 206 Query: 198 LSKIRVVRKA-IARVYIVYHQKM---KVNLRNHYKNKKYKPLDLRAKKTRAMRKALTKHE 365 +V RK + R+ +Q + +V LRN +N+K + + R R + + + Sbjct: 207 FESYKVERKTYLPRINTDKNQSLIPGQVTLRNRNRNRKSCVSYIASGTVRTPRGSSSDNA 266 Query: 366 AKIKTRKEIRKKSLF 410 + K R R+ SLF Sbjct: 267 KQGKIRPNQRRVSLF 281 >SB_29128| Best HMM Match : Ank (HMM E-Value=2.9e-19) Length = 454 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +3 Query: 258 KMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVY 425 K K R +NK Y +DL+ +++ A+ K + + IR++ +F P +Y Sbjct: 18 KWKRQTRGKQENKLYSFVDLKGEQSDALLVEAFKKGGLDEVNRLIREEGVFLPYLY 73 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 276 RNHYKNKKYKPLDLRAKKTRAMRKALTKHEAKIKTRKEIR 395 + +K K+ K D + +K+RA + LTK + +IK E+R Sbjct: 289 KKKHKKKEKKEKDEK-RKSRAEDEGLTKEQLEIKEANELR 327 >SB_4336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 234 RVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTKHEAKI--KTRKEIRKKS 404 R +V + VN+R+ NKK+K ++ R++ M+ + +K+ K K + K+S Sbjct: 23 RPKVVNMRSKVVNMRSKVVNKKFKAVNKRSRAVN-MKSTVVSMRSKVVDKRSKSVDKRS 80 >SB_9162| Best HMM Match : Ribosomal_L19e (HMM E-Value=3.4) Length = 160 Score = 27.1 bits (57), Expect = 7.7 Identities = 22/83 (26%), Positives = 41/83 (49%) Frame = +3 Query: 153 TNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKT 332 TN V ++ G + + R ++K R+ +++K R K K K R++K Sbjct: 24 TNAVVFVLSQGKIRSIERQRQIKKLTKRI-----KRIKALNRGKRKKKHSK----RSQKL 74 Query: 333 RAMRKALTKHEAKIKTRKEIRKK 401 R MR+ L + + K K+ ++ R+K Sbjct: 75 REMRRWLRRFKQKGKSDRDARRK 97 >SB_5012| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 726 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 421 TLGGKRDFFLISFLVLIFASCLVRALRIARVFLALKS 311 TL G R F L++ S LV+ RIAR+F KS Sbjct: 511 TLCGIRRFGTGISFCLLYTSLLVKTNRIARIFSGTKS 547 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,303,279 Number of Sequences: 59808 Number of extensions: 181023 Number of successful extensions: 535 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 957531822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -