BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b20 (366 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 21 3.0 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 3.9 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 21.4 bits (43), Expect = 3.0 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 43 VLSHFHVNPTAPSLQNAK 96 VL H PT LQN K Sbjct: 29 VLGDIHAKPTYSDLQNLK 46 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.0 bits (42), Expect = 3.9 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +2 Query: 158 LLNHQGALLAYSGYNDKDARVTAAIASNVWSAYE 259 L H G+++ G +A + I N +AYE Sbjct: 138 LTRHDGSVIKNQGMPTMEAIARSGIWENCRAAYE 171 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,576 Number of Sequences: 336 Number of extensions: 1138 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7510735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -