BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b18 (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 22 4.3 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 5.7 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 Query: 216 RTAEEWAKSRRPEVWTALV 160 R + +++ P+VW ALV Sbjct: 76 RRIARYVQTKHPDVWNALV 94 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 5.7 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +2 Query: 350 AAPSDLRQPTPVTAYVHKSAAPAPDVRQSARAASATTGPAITSAD 484 AA ++L +P P + + SAAP R++ +++ + +G + D Sbjct: 102 AAAANLLRPHPYLSPLFHSAAPRTASRET-KSSESDSGASSADPD 145 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,007 Number of Sequences: 336 Number of extensions: 1078 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -