BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b18 (578 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 1.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.2 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 3.8 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 5.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.0 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 5.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 5.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 5.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 5.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 5.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 5.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 5.0 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.0 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.4 bits (48), Expect = 1.6 Identities = 14/59 (23%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 200 HSSAVLYNSPSTPSDDD*TANTPAVHNISSTFS-SIHGVSAAFAAIYDCSSAAPSDLRQ 373 HS N PS D+D + ++ +++ST S A A +++ ++ P ++ Q Sbjct: 384 HSFPSTLNIPSVKIDEDQKCSIESITSVNSTSSPKPFPRRATLAQLHNFTTMTPQEIAQ 442 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 246 SSEGVLGELYRTAEEWAKSRRPE 178 SS+G+LGE E +KSR E Sbjct: 376 SSQGILGEDVENNSEVSKSRTKE 398 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 373 THPRYRLC 396 THPR+RLC Sbjct: 171 THPRHRLC 178 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 59 FILTIVRKRAVLCGVP 106 F+ TIV +LCG P Sbjct: 437 FLTTIVSTTVILCGSP 452 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 245 HRRECWGSYTERRRSGQ 195 HRRE W ER R Q Sbjct: 38 HRREAWLIQQEREREHQ 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,107 Number of Sequences: 438 Number of extensions: 1561 Number of successful extensions: 21 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -