BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b17 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.4 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 7.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.2 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.6 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -3 Query: 176 MSFNIDPHVTNSFFAASVFSLIIEMRNTTVTKV 78 +S+N+ H+ F F I+++RN ++ ++ Sbjct: 342 LSYNMLTHIDARMFKDLFFLQILDLRNNSIDRI 374 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 437 HDTS*LPERGEVKKC 393 H+ LPERGE+ C Sbjct: 303 HEFQILPERGELGHC 317 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -1 Query: 298 GEPASDYCYHQRPQPPSQTAVLIQTHTLHHANEV 197 G PA+ Q P S A+ H HH E+ Sbjct: 446 GSPATTAAPPQLPTEESVDALCNTLHHWHHCPEI 479 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 576 IWSSHQWSRRD 608 IW+ H W RR+ Sbjct: 177 IWTPHGWMRRN 187 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 9.6 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +3 Query: 564 LRANIWSSHQW 596 L N+W H+W Sbjct: 67 LTTNVWLEHEW 77 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 533 DMLILDRILQAP 568 DM +L R+LQAP Sbjct: 617 DMPVLKRVLQAP 628 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,105 Number of Sequences: 438 Number of extensions: 3304 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -