BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b17 (616 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25110.1 68415.m03004 MIR domain-containing protein similar t... 143 9e-35 At4g37380.1 68417.m05293 pentatricopeptide (PPR) repeat-containi... 29 1.9 At2g30575.1 68415.m03725 glycosyl transferase family 8 protein c... 28 4.3 >At2g25110.1 68415.m03004 MIR domain-containing protein similar to SP|Q99470 Stromal cell-derived factor 2 precursor (SDF-2) {Homo sapiens}; contains Pfam profile PF02815: MIR domain Length = 218 Score = 143 bits (346), Expect = 9e-35 Identities = 69/158 (43%), Positives = 96/158 (60%), Gaps = 2/158 (1%) Frame = +1 Query: 148 VTCGSILKLINTDLKLRLHSHDVKYGSGSGQQSVTAVEVSDDNNSHWLVRPMTGETCKRG 327 +T GS +KL++ K RLHSHDV YGSGSGQQSVT D+NS+W+V+P+ G T K+G Sbjct: 37 ITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPGTTEKQG 96 Query: 328 APIKCNTNIRLQHVATKKNLHSHFFTSPLSGNQEVSCYXXXXXXXXXXXNWTVVC--NND 501 +K IRLQH+ T+K LHSH SP+SGN EVSC+ +W ++ + Sbjct: 97 DAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCF-GDDTNSDTGDHWKLIIEGSGK 155 Query: 502 YWRRDTPVKFRHVDTGSYLAGSGRTFGRPINGQGEIVG 615 W++D V+ +H+DT YL + + R GQ E+ G Sbjct: 156 TWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCG 193 >At4g37380.1 68417.m05293 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 632 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +1 Query: 70 SIATLVTVVFLISIISEKTEAAKNEFVTCGSILKLINTDLKLRLHSHDVKYGSG 231 SI L FL+ + +E NEF T S+LK +T +H+H +K+G G Sbjct: 106 SINGLKDQAFLLYVQLLSSEINPNEF-TFSSLLKSCSTKSGKLIHTHVLKFGLG 158 >At2g30575.1 68415.m03725 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 610 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 245 DCCPDPDPYFTSCE*SLNFKSVLMSFNIDPHVTNSFFAASVFSLIIEMRNTTVTKVAIE 69 + C + DP + S + +NF +S DP F ++F L E R +T V ++ Sbjct: 458 ETCLEGDPSYRSMDSFINFSDAWVSQKFDPKACTWAFGMNLFDL-EEWRRQELTSVYLK 515 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,189,297 Number of Sequences: 28952 Number of extensions: 258230 Number of successful extensions: 632 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -