BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b15 (623 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 3.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.8 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 9.8 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 24.2 bits (50), Expect = 1.0 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 208 VNKLDHVLPLTTR-MPNIKVFSGSSHPDLAQKIVDRLGIDLGKVVTKKFSNM 360 V+ +PL R +PN F S H + L +GK+V +KFS + Sbjct: 218 VHSSSFCIPLPVRVLPN---FPSSGHWQDQMSLPQMLADKIGKMVNQKFSEL 266 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 229 LPLTTRMPNIKVFSGSSHPDLAQKIVDRLGIDLGKVVTKKFSNMETC 369 LPL R G S LA+K+ DR+ + + V+T + + C Sbjct: 612 LPLNIRWSYPGEEMGGSSGVLAKKVADRVSMLMISVITARHAGEYVC 658 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 Query: 17 AIREGHRCRIHGATRPHALP 76 A+ G CRIHG+ A P Sbjct: 435 AVNLGSACRIHGSPATTAAP 454 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 114 IIHLCFIASHSATCY 158 II F H+ATCY Sbjct: 305 IISSVFTTRHNATCY 319 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 114 IIHLCFIASHSATCY 158 II F H+ATCY Sbjct: 11 IISSVFTTRHNATCY 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,909 Number of Sequences: 438 Number of extensions: 3049 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -