BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b14 (350 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0032 + 10775031-10775520,10775661-10776246,10776333-107769... 29 1.0 06_02_0028 + 10755164-10755668,10755740-10756283,10756372-10758247 28 1.8 02_05_1320 - 35693575-35694846 27 3.1 12_02_0076 + 13284747-13285434,13285507-13285829 26 7.2 03_02_0583 + 9635002-9637299 26 7.2 01_06_1801 - 39954425-39954533,39955289-39955578,39955786-399568... 26 9.6 >06_02_0032 + 10775031-10775520,10775661-10776246,10776333-10776973, 10777270-10777973 Length = 806 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 121 IVIMSIGLTCFGLALGYIAYMRQKYESMGYYSAI 222 ++ ++I L GL L Y+A R + ES GY+ A+ Sbjct: 752 VMNITIVLNLLGLLLAYMAGSRMRLESSGYFIAL 785 >06_02_0028 + 10755164-10755668,10755740-10756283,10756372-10758247 Length = 974 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 118 NIVIMSIGLTCFGLALGYIAYMRQKYESMGYY 213 N++ ++I L GL L Y+A R + +S GY+ Sbjct: 908 NVMNITIVLDLLGLLLAYMAGSRMRLQSSGYF 939 >02_05_1320 - 35693575-35694846 Length = 423 Score = 27.5 bits (58), Expect = 3.1 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +1 Query: 67 RSTTAFRVVNFELYAKPNIVIMSIGLTCFGLALGYIAYMRQKYESMGYYSAIDKD 231 R+ AFR + EL KP++V ++ L F +A G +A R ++ M + ++ D Sbjct: 164 RAIQAFRTLPAELGIKPSVVSHNVLLKSF-VASGDLASARALFDEMPSKADVEPD 217 >12_02_0076 + 13284747-13285434,13285507-13285829 Length = 336 Score = 26.2 bits (55), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 208 YYSAIDKDGKEIFEKKKSKWD 270 Y + +KD K+IF++ K+ WD Sbjct: 245 YLDSTEKDVKKIFDRFKNDWD 265 >03_02_0583 + 9635002-9637299 Length = 765 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 131 IMTILGFAYSSKLTTLNAVVDRIDR 57 IM +LG + + K T ++A+ DRI R Sbjct: 144 IMAVLGASGAGKTTLIDALADRIQR 168 >01_06_1801 - 39954425-39954533,39955289-39955578,39955786-39956838, 39956998-39957263,39957345-39957420,39957525-39957605, 39957676-39957831,39958565-39958669,39958761-39959367, 39959514-39959585,39959802-39959953,39960063-39960240, 39960642-39960745,39960822-39960953,39961036-39961132, 39961280-39961407,39961533-39961592,39962799-39962918, 39963011-39963091,39963173-39963361,39963826-39964024, 39964177-39964257,39964398-39964588,39965226-39965382, 39965986-39966119,39966266-39966334,39966434-39966481, 39966572-39966646,39967112-39967192,39967399-39967461, 39967564-39967623,39967754-39967795,39968777-39968902, 39969027-39969176 Length = 1843 Score = 25.8 bits (54), Expect = 9.6 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -1 Query: 266 HFDFFFSKISFPSLSIAE*YPIDSYFCRMYAMYPRA 159 HFD +++ L E YP ++ FC++ ++P++ Sbjct: 204 HFDLDPNRVFDIVLECFELYPDNTIFCQLIPLFPKS 239 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,148,284 Number of Sequences: 37544 Number of extensions: 148479 Number of successful extensions: 337 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 518263348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -