BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b10 (712 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14973| Best HMM Match : THAP (HMM E-Value=1.9e-05) 41 9e-04 SB_47920| Best HMM Match : Kelch_1 (HMM E-Value=1.9e-34) 30 2.1 >SB_14973| Best HMM Match : THAP (HMM E-Value=1.9e-05) Length = 317 Score = 41.1 bits (92), Expect = 9e-04 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 496 CAVLGC-DDCKNMDSIMFFRFPEDSSLRQIWTDLTG-RNNWTPTDFSYICIPHFSVDCFK 669 CAV GC +D + I F R P++ SLR+ W ++ R ++ +C HFS D +K Sbjct: 4 CAVPGCKNDSRKTQGISFHRSPQEPSLRRKWAEIVACRVHFADLPKYCVCSDHFSNDSYK 63 >SB_47920| Best HMM Match : Kelch_1 (HMM E-Value=1.9e-34) Length = 405 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 666 ETIYREVWYANIGKICWSPIIS 601 E ++RE+W NI CWS +I+ Sbjct: 50 EKLFRELWRFNIASQCWSRVIT 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,713,466 Number of Sequences: 59808 Number of extensions: 350119 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -