BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b09 (428 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 25 6.6 SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 6.6 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 24.6 bits (51), Expect = 6.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 116 LPSESDITT*NECIRTI*VIFTKL 45 LP+ESDI+ NE RT+ + T L Sbjct: 1695 LPAESDISKTNETTRTLQSLTTSL 1718 >SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 237 Score = 24.6 bits (51), Expect = 6.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -2 Query: 160 LIQHCLPRTHSPNSYYLPNPTLLLKTNAFEPFR 62 LI LP+ P+ + N T LKTN FEP R Sbjct: 185 LITLPLPQKQ-PDFLRMNNDTNELKTNGFEPIR 216 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,321,721 Number of Sequences: 5004 Number of extensions: 22971 Number of successful extensions: 62 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -