BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b09 (428 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK000902-1|BAA91416.1| 407|Homo sapiens protein ( Homo sapiens ... 29 8.8 >AK000902-1|BAA91416.1| 407|Homo sapiens protein ( Homo sapiens cDNA FLJ10040 fis, clone HEMBA1001009. ). Length = 407 Score = 28.7 bits (61), Expect = 8.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 196 PTDSMQRCDVIVLIQHCLPRTHSPNSYYLPNPT 98 P S R + ++ + +P HSP + +LP PT Sbjct: 225 PPGSPSRSQAVKVLSNLVPAGHSPPASHLPRPT 257 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,431,521 Number of Sequences: 237096 Number of extensions: 933400 Number of successful extensions: 1823 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1823 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -