BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b07 (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 1.3 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 22 4.1 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 177 RNIVVFVLRLLDATKCIQIELSKLLYPRCRVALT 76 RNI+V L ++ T C++I+++ + RV L+ Sbjct: 739 RNIIVGTLMMVLGTGCVRIKITGVWLKFLRVILS 772 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.1 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = -3 Query: 637 FIXLIQFLNEN*TLHMQTLQ-----KINHYWFE*ILTSSRLLLSKLNC 509 FI F+N TLH T + ++ + IL S RLLL+ +NC Sbjct: 13 FIIFSDFVNGK-TLHRSTRDDKYTTRYDNVDVDRILHSKRLLLNYINC 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,716 Number of Sequences: 336 Number of extensions: 2839 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -