BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b07 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 36 0.001 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 36 0.001 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 32 0.015 AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like pepti... 27 0.55 DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 23 9.0 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 35.9 bits (79), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 428 KSKRGPGLVDECCLKPCYTYDLLNYC 505 + RG G+V+ECCL+PC LL YC Sbjct: 130 RKNRG-GIVEECCLRPCGMNQLLQYC 154 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 35.9 bits (79), Expect = 0.001 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 428 KSKRGPGLVDECCLKPCYTYDLLNYC 505 + RG G+V+ECCL+PC LL YC Sbjct: 130 RKNRG-GIVEECCLRPCGMNQLLQYC 154 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 32.3 bits (70), Expect = 0.015 Identities = 24/88 (27%), Positives = 35/88 (39%), Gaps = 6/88 (6%) Frame = +2 Query: 260 YCGRHLANARMVLC---YDTVEKRAQSYL--DANIISAGDLSSWPGLSSQYAKTRAFALA 424 YCGR L LC Y + Y+ AN ++++ P + Sbjct: 46 YCGRRLTETLAFLCQGRYPMLTHYRTDYVHDQANQRVKVEVATLPDTLPPGFPYPGAGVH 105 Query: 425 EKSKRGPG-LVDECCLKPCYTYDLLNYC 505 +S+R G + DECC K C +L YC Sbjct: 106 RRSRRSSGGIYDECCKKSCSYVELRAYC 133 >AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like peptide 4 precursor protein. Length = 160 Score = 27.1 bits (57), Expect = 0.55 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 449 LVDECCLKPCYTYDLLNYC 505 + DECC + C LL+YC Sbjct: 132 VADECCREDCSMAQLLSYC 150 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 287 VRWPNDVRNRPEDFPQFSTLCRGRQHSP 204 V W N P+ +P+ RG++ SP Sbjct: 3 VTWGYTQMNGPQKWPEMFPQARGQRQSP 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,094 Number of Sequences: 2352 Number of extensions: 11174 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -