BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b05 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57330| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 69 4e-12 SB_43441| Best HMM Match : Lipase (HMM E-Value=8.19998e-41) 30 2.1 SB_55446| Best HMM Match : Sec7 (HMM E-Value=8.1) 28 8.5 >SB_57330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 68.9 bits (161), Expect = 4e-12 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = +3 Query: 117 LLNHQGALLAYSGYNDKDARVTAAIASNVWSAYEKHGRNVFKEDGLHLILVDC 275 LLN++G++L+YSG DK+A TAAIAS++WSAYEK+GR F + + ++ +DC Sbjct: 2 LLNNEGSILSYSGNGDKEANKTAAIASSIWSAYEKNGRIAFHNEEIKMLFMDC 54 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 68.9 bits (161), Expect = 4e-12 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = +3 Query: 117 LLNHQGALLAYSGYNDKDARVTAAIASNVWSAYEKHGRNVFKEDGLHLILVDC 275 LLN++G++L+YSG DK+A TAAIAS++WSAYEK+GR F + + ++ +DC Sbjct: 2 LLNNEGSILSYSGNGDKEANKTAAIASSIWSAYEKNGRIAFHNEEIKMLFMDC 54 >SB_43441| Best HMM Match : Lipase (HMM E-Value=8.19998e-41) Length = 291 Score = 29.9 bits (64), Expect = 2.1 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +3 Query: 72 EVLSQANTGGVENTLLLNHQGALLAYSGYNDKDARVTAAIASNVWSAYEKHGRNVFKEDG 251 EVLS A+T +E + L H+ GY D+ V + I W + K D Sbjct: 67 EVLSDADTATIEKSSFLPHRTTRFIVHGYAGLDS-VDSIIDLKGWWGIRMKDELLRKSDD 125 Query: 252 LHLILVDCLNG-KIA-ITQVANLLL 320 ++I+VD + G KI + VAN L Sbjct: 126 -NVIIVDWIRGAKIPYVRAVANTRL 149 >SB_55446| Best HMM Match : Sec7 (HMM E-Value=8.1) Length = 344 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 96 GGVENTLLLNHQGALLAYSGYNDKDAR 176 G E+ LL +HQ + A GY D D++ Sbjct: 144 GRAEDRLLFDHQSRVAALLGYEDSDSK 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,214,007 Number of Sequences: 59808 Number of extensions: 314242 Number of successful extensions: 628 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -