BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10b04 (627 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mit... 134 2e-30 UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mit... 87 4e-16 UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mit... 82 1e-14 UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein ... 62 8e-09 UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; ... 55 1e-06 UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; ... 50 5e-05 UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; ... 46 7e-04 UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypa... 45 0.001 UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial p... 44 0.003 UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotinia... 42 0.012 UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA... 40 0.049 UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium... 40 0.065 UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmo... 38 0.26 UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n... 37 0.34 UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; ... 36 1.1 UniRef50_A6R851 Cluster: Predicted protein; n=1; Ajellomyces cap... 35 1.4 UniRef50_Q96GP6 Cluster: Scavenger receptor class F member 2 pre... 35 1.8 UniRef50_UPI0000E48947 Cluster: PREDICTED: similar to MEGF6; n=1... 34 2.4 UniRef50_Q1DF55 Cluster: Dual specificity phosphatase; n=1; Myxo... 34 3.2 UniRef50_Q9NYQ7 Cluster: Cadherin EGF LAG seven-pass G-type rece... 34 3.2 UniRef50_UPI0000E4979B Cluster: PREDICTED: similar to LOC495490 ... 33 5.6 UniRef50_Q7RFK8 Cluster: NLI interacting factor, putative; n=2; ... 33 5.6 UniRef50_UPI000065F4A6 Cluster: Homolog of Homo sapiens "Keratin... 33 7.4 UniRef50_Q4RX38 Cluster: Chromosome 11 SCAF14979, whole genome s... 33 7.4 UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirill... 33 7.4 UniRef50_A7CAE1 Cluster: Putative uncharacterized protein; n=1; ... 33 7.4 UniRef50_Q01B17 Cluster: Chromosome 04 contig 1, DNA sequence; n... 33 7.4 UniRef50_Q4U971 Cluster: SWI/SNF-related chromatin remodelling f... 33 7.4 UniRef50_Q16ZG2 Cluster: EGF repeat molecule, putative; n=3; End... 33 7.4 UniRef50_A7Q3H8 Cluster: Chromosome chr13 scaffold_48, whole gen... 32 9.8 UniRef50_A5C0R4 Cluster: Putative uncharacterized protein; n=1; ... 32 9.8 UniRef50_Q4H3A0 Cluster: Zinc finger protein; n=1; Ciona intesti... 32 9.8 UniRef50_A7SLE6 Cluster: Predicted protein; n=1; Nematostella ve... 32 9.8 UniRef50_A2EEG8 Cluster: Metallothionein family protein; n=4; Tr... 32 9.8 >UniRef50_Q9U505 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=143; Eukaryota|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 131 Score = 134 bits (323), Expect = 2e-30 Identities = 70/98 (71%), Positives = 73/98 (74%) Frame = +3 Query: 120 FCNSALVRPLAAVPTHTQMVPAVPTQLSAVRSFQTTSVTKDIDSAAKFXXXXXXXXXXXX 299 F N+A+VRPLAAV T TQ+VPA P QLSAVRSFQTTSVTKDIDSAAKF Sbjct: 17 FSNAAVVRPLAAVSTQTQLVPAAPAQLSAVRSFQTTSVTKDIDSAAKFIGAGAATVGVAG 76 Query: 300 XXXXXXXXFGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 77 SGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 114 >UniRef50_P05496 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=16; Eutheria|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 136 Score = 86.6 bits (205), Expect = 4e-16 Identities = 52/104 (50%), Positives = 63/104 (60%), Gaps = 7/104 (6%) Frame = +3 Query: 123 CNSALVRPLAAV----PTHTQMVPAV---PTQLSAVRSFQTTSVTKDIDSAAKFXXXXXX 281 C L+RP++A P ++ P+ P Q+ A R FQT+ V++DID+AAKF Sbjct: 17 CTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQV-ARREFQTSVVSRDIDTAAKFIGAGAA 75 Query: 282 XXXXXXXXXXXXXXFGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 76 TVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 119 >UniRef50_P48201 Cluster: ATP synthase lipid-binding protein, mitochondrial precursor; n=111; cellular organisms|Rep: ATP synthase lipid-binding protein, mitochondrial precursor - Homo sapiens (Human) Length = 142 Score = 81.8 bits (193), Expect = 1e-14 Identities = 41/68 (60%), Positives = 47/68 (69%) Frame = +3 Query: 210 RSFQTTSVTKDIDSAAKFXXXXXXXXXXXXXXXXXXXXFGSLIIGYARNPSLKQQLFSYA 389 R FQT+++++DID+AAKF FGSLIIGYARNPSLKQQLFSYA Sbjct: 58 REFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYA 117 Query: 390 ILGFALSE 413 ILGFALSE Sbjct: 118 ILGFALSE 125 >UniRef50_UPI0000E25CD7 Cluster: PREDICTED: hypothetical protein isoform 2; n=1; Pan troglodytes|Rep: PREDICTED: hypothetical protein isoform 2 - Pan troglodytes Length = 80 Score = 62.5 bits (145), Expect = 8e-09 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = -2 Query: 455 EQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCRC 276 E ++ HH+ + H L +G+ Q+GV E+LLL+ VPGI +DE + N S S+ +C Sbjct: 8 EDEKGHHQAKAPHGLSEGKAQSGVGEELLLQRRVPGITNDEAPKHSPNLSRRASHPNCGS 67 Query: 275 TSTNEFGSRVNV 240 S+NE G V+V Sbjct: 68 PSSNELGCCVDV 79 >UniRef50_P48880 Cluster: ATP synthase protein 9, mitochondrial; n=4; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Chondrus crispus (Carragheen) Length = 76 Score = 55.2 bits (127), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSL++ YARNPSLKQQLF Y ILGFAL+E Sbjct: 31 FGSLVMAYARNPSLKQQLFGYTILGFALTE 60 >UniRef50_Q01554 Cluster: ATP synthase protein 9, mitochondrial; n=22; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Trichophyton rubrum Length = 74 Score = 50.0 bits (114), Expect = 5e-05 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FG+LI+G ARNPSL+ LFSYAILGFA SE Sbjct: 28 FGALILGVARNPSLRGLLFSYAILGFAFSE 57 >UniRef50_P60112 Cluster: ATP synthase protein 9, mitochondrial; n=72; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Arabidopsis thaliana (Mouse-ear cress) Length = 85 Score = 46.0 bits (104), Expect = 7e-04 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F SLI ARNPSL +QLF YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQLFGYAILGFALTE 68 >UniRef50_Q4Q9E5 Cluster: ATPase subunit 9, putative; n=15; Trypanosomatidae|Rep: ATPase subunit 9, putative - Leishmania major Length = 252 Score = 45.2 bits (102), Expect = 0.001 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FG L+IG AR P+L + LF+YAILGFAL+E Sbjct: 207 FGCLLIGCARQPNLTKMLFNYAILGFALTE 236 >UniRef50_P00842 Cluster: ATP synthase protein 9, mitochondrial precursor; n=14; Pezizomycotina|Rep: ATP synthase protein 9, mitochondrial precursor - Neurospora crassa Length = 147 Score = 44.0 bits (99), Expect = 0.003 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F +L+ G ARNP+L+ QLFSYAILGFA E Sbjct: 102 FAALLNGVARNPALRGQLFSYAILGFAFVE 131 >UniRef50_A6RZ18 Cluster: Lipid-binding protein; n=2; Sclerotiniaceae|Rep: Lipid-binding protein - Botryotinia fuckeliana B05.10 Length = 149 Score = 41.9 bits (94), Expect = 0.012 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F +L+ ARNPS++ QLFSYAILGFA E Sbjct: 104 FAALLQAVARNPSMRGQLFSYAILGFAFVE 133 >UniRef50_UPI0000D573BE Cluster: PREDICTED: similar to CG13320-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG13320-PA, isoform A - Tribolium castaneum Length = 378 Score = 39.9 bits (89), Expect = 0.049 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +3 Query: 192 TQLSAVRSFQTTSVTKDIDSAAKF 263 T L AVRSFQTT V++DIDSAAKF Sbjct: 30 TLLPAVRSFQTTPVSRDIDSAAKF 53 >UniRef50_A3E3Y1 Cluster: Lipid-binding protein; n=1; Karlodinium micrum|Rep: Lipid-binding protein - Karlodinium micrum (Dinoflagellate) Length = 130 Score = 39.5 bits (88), Expect = 0.065 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F +L++G ARNPS+K+ LF+Y ++G E Sbjct: 84 FAALVVGMARNPSMKEDLFTYTLIGMGFLE 113 >UniRef50_Q7RI18 Cluster: ATPase subunit 9, putative; n=4; Plasmodium|Rep: ATPase subunit 9, putative - Plasmodium yoelii yoelii Length = 189 Score = 37.5 bits (83), Expect = 0.26 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F +L++G +RNPS+K +LF+Y ++G E Sbjct: 120 FSALVLGTSRNPSIKDELFTYTLIGMGFLE 149 >UniRef50_Q4N435 Cluster: ATP synthase F0, subunit C, putative; n=3; Piroplasmida|Rep: ATP synthase F0, subunit C, putative - Theileria parva Length = 163 Score = 37.1 bits (82), Expect = 0.34 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F +L+ G ARNPS+K+ LF+Y ++G E Sbjct: 118 FAALVSGTARNPSIKEDLFTYTLIGMGFLE 147 >UniRef50_Q37315 Cluster: ATP synthase protein 9, mitochondrial; n=11; Eukaryota|Rep: ATP synthase protein 9, mitochondrial - Dictyostelium discoideum (Slime mold) Length = 88 Score = 35.5 bits (78), Expect = 1.1 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F + I+ NP+L+ +LF A+LGFALSE Sbjct: 43 FAAFILAVGMNPNLRGELFKLAMLGFALSE 72 >UniRef50_A6R851 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 456 Score = 35.1 bits (77), Expect = 1.4 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +2 Query: 101 CSQVCHLLQL--CTGATTCSSTHPYTDGTCCPYTALCSAVLP 220 C Q HL + C + P+ DGTCCP+ +L +P Sbjct: 57 CDQAIHLFHVKETLYLLRCRQSTPHLDGTCCPHLSLADGAIP 98 >UniRef50_Q96GP6 Cluster: Scavenger receptor class F member 2 precursor; n=20; Tetrapoda|Rep: Scavenger receptor class F member 2 precursor - Homo sapiens (Human) Length = 866 Score = 34.7 bits (76), Expect = 1.8 Identities = 30/100 (30%), Positives = 40/100 (40%), Gaps = 6/100 (6%) Frame = -2 Query: 365 EGGVPGIADDEGAEDCSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRD 186 +G GIA EG CS CRC FG+ + R GP C+ELC Sbjct: 71 QGDECGIAVCEGNSTCSENEVCVRPGECRCRH-GYFGANCDTKCPR-QFWGPDCKELCSC 128 Query: 185 SRYHLC--MGGYC-C---KWSHQCRVAEDGRPGCRGDQSG 84 + C + G C C +W +C A + G +SG Sbjct: 129 HPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSG 168 >UniRef50_UPI0000E48947 Cluster: PREDICTED: similar to MEGF6; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to MEGF6 - Strongylocentrotus purpuratus Length = 1509 Score = 34.3 bits (75), Expect = 2.4 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 2/77 (2%) Frame = -2 Query: 326 EDCSNTSSGTSYSH-CRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYC- 153 E+C N + G + CRC + S G G C++ CR+ Y L G C Sbjct: 202 EECQNETYGPECTRTCRCRNKAVCDPIDGTCSCAPGYIGEFCQDECREGSYGLGCSGMCV 261 Query: 152 CKWSHQCRVAEDGRPGC 102 C+ +C EDG C Sbjct: 262 CENGARCH-HEDGNCIC 277 >UniRef50_Q1DF55 Cluster: Dual specificity phosphatase; n=1; Myxococcus xanthus DK 1622|Rep: Dual specificity phosphatase - Myxococcus xanthus (strain DK 1622) Length = 193 Score = 33.9 bits (74), Expect = 3.2 Identities = 19/41 (46%), Positives = 21/41 (51%) Frame = -1 Query: 210 ALQRAV*GQQVPSVYGWVLLQVVAPVQSCRRWQTWLQGRSV 88 AL R V VP V GWV QV+ V C W T L GR + Sbjct: 4 ALLREV--HHVPGVRGWVRKQVLRSVARCVEWTTKLPGRGL 42 >UniRef50_Q9NYQ7 Cluster: Cadherin EGF LAG seven-pass G-type receptor 3 precursor; n=60; Eukaryota|Rep: Cadherin EGF LAG seven-pass G-type receptor 3 precursor - Homo sapiens (Human) Length = 3312 Score = 33.9 bits (74), Expect = 3.2 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -2 Query: 353 PGIADDEG---AEDCSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEG 213 PG+A+ G A DC S++ CRC+ T FG ++ S R LEG Sbjct: 2486 PGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTFGVLMDA-SPRERLEG 2534 >UniRef50_UPI0000E4979B Cluster: PREDICTED: similar to LOC495490 protein; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to LOC495490 protein - Strongylocentrotus purpuratus Length = 720 Score = 33.1 bits (72), Expect = 5.6 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +1 Query: 13 AGLLLLGVLCCRAPHLIKTKCCLPPD*SPLQPGLPSSATL 132 AG LLLGVLC R+PHL++ P L L S++ L Sbjct: 555 AGALLLGVLCNRSPHLLRAAVMRMPFVDILSSMLDSTSPL 594 >UniRef50_Q7RFK8 Cluster: NLI interacting factor, putative; n=2; Plasmodium (Vinckeia)|Rep: NLI interacting factor, putative - Plasmodium yoelii yoelii Length = 1177 Score = 33.1 bits (72), Expect = 5.6 Identities = 17/77 (22%), Positives = 35/77 (45%) Frame = -2 Query: 494 VVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCS 315 V V + VNS + + K +++ T+N + + +E P I+ + +E+ Sbjct: 108 VNVNVNVNSNDISNNDKFSDKINTNYNIENSGTENNIYNKQRIEYNYPNISYNHDSENWK 167 Query: 314 NTSSGTSYSHCRCTSTN 264 N +G ++ CT+ N Sbjct: 168 NNENGIMFNTRTCTNNN 184 >UniRef50_UPI000065F4A6 Cluster: Homolog of Homo sapiens "Keratin associated protein 5-9; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Keratin associated protein 5-9 - Takifugu rubripes Length = 191 Score = 32.7 bits (71), Expect = 7.4 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 74 AVCRQTDRPCSQV-CHLLQLCTGATTCSSTHPYTDGTCCPYTALCSAVLP 220 A CR CS CH L LC G + C P C +LC +++P Sbjct: 120 APCRGLSPCCSLASCHGLSLCHGLSLCRGLSPCCSLAPCRGLSLCHSLIP 169 >UniRef50_Q4RX38 Cluster: Chromosome 11 SCAF14979, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 11 SCAF14979, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1408 Score = 32.7 bits (71), Expect = 7.4 Identities = 30/104 (28%), Positives = 40/104 (38%), Gaps = 9/104 (8%) Frame = -2 Query: 356 VPGIADDEGAEDCSNTSSGTSYSH----CRCTSTNEFGSRVNVLSDRC----GLEGPHCR 201 +PG + + CS G S H C C G+ S RC G +GP C Sbjct: 992 LPGSYGTDCVQRCS-CPRGASCHHISGECGCPP-GLMGNGCEQTSGRCYCAPGFDGPRCD 1049 Query: 200 ELCRDSRYHLCMGGYC-CKWSHQCRVAEDGRPGCRGDQSGGRQH 72 +C++ RY G C C+ +C V G C G R H Sbjct: 1050 RICKEGRYGPGCEGECRCENGGRC-VPSTGACECPPGFIGARCH 1092 >UniRef50_Q5FRW6 Cluster: ATP synthase C chain; n=4; Rhodospirillales|Rep: ATP synthase C chain - Gluconobacter oxydans (Gluconobacter suboxydans) Length = 85 Score = 32.7 bits (71), Expect = 7.4 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F +LI ARNP+ + +F +LGFAL+E Sbjct: 40 FSTLISSVARNPASRPHVFGIGMLGFALTE 69 >UniRef50_A7CAE1 Cluster: Putative uncharacterized protein; n=1; Ralstonia pickettii 12D|Rep: Putative uncharacterized protein - Ralstonia pickettii 12D Length = 477 Score = 32.7 bits (71), Expect = 7.4 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 308 SSGTSYSHCR-CTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQC 132 S T + R C + R++ +S R G+E P C C++S Y C C+ Q Sbjct: 88 SCSTYFREARACGICGQLTRRLSRVS-RLGIELPVCPN-CQESDYATCA---LCRRYRQL 142 Query: 131 RVAEDGRPGCRGDQSGG 81 R+ GR CR + GG Sbjct: 143 RLDRTGRSVCRSCEEGG 159 >UniRef50_Q01B17 Cluster: Chromosome 04 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 04 contig 1, DNA sequence - Ostreococcus tauri Length = 244 Score = 32.7 bits (71), Expect = 7.4 Identities = 28/97 (28%), Positives = 34/97 (35%), Gaps = 1/97 (1%) Frame = +2 Query: 71 NAVCRQTDRPCSQVCHLLQLCTGATTCSSTHPYTDGTCCPYTALCSAVLPDHIGH*GH*L 250 N R RP C L TC++ P CP LC+A L Sbjct: 123 NLSTRAPSRPKRARCTLP--ARSRDTCAN--PGNTSPMCPRRCLCTAYTCIRAPRTRCRL 178 Query: 251 CCQIHWCWCSDSGSSWFRSWYWNSLRLPH-HRLCQEP 358 CC WC+D SW R+ + L R C EP Sbjct: 179 CCPFLRGWCTDGRRSWRRTTSQGRMCLCRVERSCTEP 215 >UniRef50_Q4U971 Cluster: SWI/SNF-related chromatin remodelling factor (ISWI homologue), putative; n=1; Theileria annulata|Rep: SWI/SNF-related chromatin remodelling factor (ISWI homologue), putative - Theileria annulata Length = 1972 Score = 32.7 bits (71), Expect = 7.4 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 362 GGVPGIADDEGAEDCSNTSSGTSYSHCRCTSTNEFGS 252 G V G+ADD G E + + G+ +H T+++E+G+ Sbjct: 1293 GEVNGVADDYGGEGTNGDTEGSVENHDNATASSEYGA 1329 >UniRef50_Q16ZG2 Cluster: EGF repeat molecule, putative; n=3; Endopterygota|Rep: EGF repeat molecule, putative - Aedes aegypti (Yellowfever mosquito) Length = 996 Score = 32.7 bits (71), Expect = 7.4 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 5/81 (6%) Frame = -2 Query: 305 SGTSYSHCRCTSTNEFGSRVNVLSDRC----GLEGPHCRELCRDSRYHLCMGGYC-CKWS 141 SGT + CR T T + G + + C G G +C E+C + Y + C CK Sbjct: 573 SGTYGNECRHTCTCKNGGECSHETGTCQCPPGWTGANCEEVCPNGFYGVNCNQKCNCKNK 632 Query: 140 HQCRVAEDGRPGCRGDQSGGR 78 +CR DG+ C G R Sbjct: 633 AKCR-KNDGQCICDPGWMGNR 652 >UniRef50_A7Q3H8 Cluster: Chromosome chr13 scaffold_48, whole genome shotgun sequence; n=5; Magnoliophyta|Rep: Chromosome chr13 scaffold_48, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 875 Score = 32.3 bits (70), Expect = 9.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +2 Query: 101 CSQVCHLLQLCTGATTCSSTHPYTDGTCCPYTALCSAVLP 220 CS++CH+ LC + C H G C P LC P Sbjct: 475 CSKLCHITPLCKHGSDC-KPHRCHYGACPPCRLLCEEEFP 513 >UniRef50_A5C0R4 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 797 Score = 32.3 bits (70), Expect = 9.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +2 Query: 101 CSQVCHLLQLCTGATTCSSTHPYTDGTCCPYTALCSAVLP 220 CS++CH+ LC + C H G C P LC P Sbjct: 492 CSKLCHITPLCKHGSDC-KPHRCHYGACPPCRLLCEEEFP 530 >UniRef50_Q4H3A0 Cluster: Zinc finger protein; n=1; Ciona intestinalis|Rep: Zinc finger protein - Ciona intestinalis (Transparent sea squirt) Length = 611 Score = 32.3 bits (70), Expect = 9.8 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 3/102 (2%) Frame = +1 Query: 67 TKCCLPPD*SPLQPGLPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPHRSLRTL 246 ++ L P SP P ++ + H ++Y R + S S+ C R H SL ++ Sbjct: 219 SEAILHPSSSPTMTSSPVTSHTYPQMHHEEYT---RARIPSESESVVCYDQRRHASLPSI 275 Query: 247 TLL---PNSLVLVQRQWE*LVPELVLEQSSAPSSSAMPGTPP 363 T+ N ++ Q L ++ S PS+S PG+PP Sbjct: 276 TITNLDENESMMQAYQQRTRSTSLTTDRCSIPSTSPNPGSPP 317 >UniRef50_A7SLE6 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 94 Score = 32.3 bits (70), Expect = 9.8 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 80 CRQTDRPCSQVCHLLQLCTGATTCSSTHPYTDGTC 184 CR T + C C TTC +TH Y TC Sbjct: 2 CRTTHSYNTTTCLTTHACNNTTTCRTTHGYNTTTC 36 >UniRef50_A2EEG8 Cluster: Metallothionein family protein; n=4; Trichomonas vaginalis G3|Rep: Metallothionein family protein - Trichomonas vaginalis G3 Length = 308 Score = 32.3 bits (70), Expect = 9.8 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 3/77 (3%) Frame = -2 Query: 323 DCSNTSSGTS-YSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCK 147 DC+ ++G S + C+C + GS + D HC E C + C G CK Sbjct: 8 DCNKQNAGKSQWFKCQCCPGCKCGSNCHCTKDNKCSPDCHCGEGCNCNEGCYCNEG--CK 65 Query: 146 WSHQCRVAEDGR--PGC 102 C +D + P C Sbjct: 66 CGSNCHCTKDNKCSPDC 82 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,463,503 Number of Sequences: 1657284 Number of extensions: 13197173 Number of successful extensions: 45377 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 42208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45274 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46051731393 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -