BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a23 (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF106592-2|AAK21364.1| 170|Caenorhabditis elegans Ferritin prot... 62 3e-10 AF016447-16|AAG24016.1| 170|Caenorhabditis elegans Ferritin pro... 52 2e-07 AF000261-10|AAB52930.1| 639|Caenorhabditis elegans Hypothetical... 27 7.7 >AF106592-2|AAK21364.1| 170|Caenorhabditis elegans Ferritin protein 2 protein. Length = 170 Score = 62.1 bits (144), Expect = 3e-10 Identities = 39/92 (42%), Positives = 49/92 (53%) Frame = +1 Query: 325 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 504 + KQI E+ AS YL+M YF D V P AK F + + EEREHAT+L+ +RG Sbjct: 16 VNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRG-- 73 Query: 505 TGSVTDLITYRAPANTSWESGASALEHALKLE 600 G V L + P N W + A E AL LE Sbjct: 74 -GRVV-LQDIQKPENDEWGTALKAFEAALALE 103 >AF016447-16|AAG24016.1| 170|Caenorhabditis elegans Ferritin protein 1 protein. Length = 170 Score = 52.4 bits (120), Expect = 2e-07 Identities = 34/92 (36%), Positives = 47/92 (51%) Frame = +1 Query: 325 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 504 + KQI E+ AS YL+M A+F D + AK F + + EER HAT+L+ +RG Sbjct: 16 VNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRG-- 73 Query: 505 TGSVTDLITYRAPANTSWESGASALEHALKLE 600 G V + + P W + A E AL LE Sbjct: 74 -GRVA-MQNIQKPEKDEWGTVLEAFEAALALE 103 >AF000261-10|AAB52930.1| 639|Caenorhabditis elegans Hypothetical protein F19B10.10 protein. Length = 639 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -2 Query: 183 SYNHRFFDDTQKNMRS*KQ*LYKSSLY 103 SYNHRFF K++ S K+ LYK+ ++ Sbjct: 99 SYNHRFF--IHKDISSDKKFLYKNDIF 123 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,172,282 Number of Sequences: 27780 Number of extensions: 234233 Number of successful extensions: 609 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -