BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a22 (665 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.6 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.0 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 181 LTVITMKSALLLLWLYVFHCEGAVIVDSN 267 LT++ M L+ LWL E +I + N Sbjct: 253 LTIVLMTMTLMTLWLEPSSTERMIIANLN 281 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 172 DDWLTVITMKSALLLLW 222 DDW +V+ + S + L+W Sbjct: 83 DDWTSVMELHSWMTLMW 99 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 156 PPNKDKLYLVLSKLLNALILNTHTYLYIIVI 64 PP L L+ LL I+NT + L ++I Sbjct: 287 PPTSLVLPLIAKYLLFTFIMNTVSILVTVII 317 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 489 SRGSNVLQPIQWI 527 +R SN+ QP QW+ Sbjct: 216 ARRSNLSQPFQWL 228 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 489 SRGSNVLQPIQWI 527 +R SN+ QP QW+ Sbjct: 306 ARRSNLSQPFQWL 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,298 Number of Sequences: 438 Number of extensions: 4259 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -