BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a21 (616 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC125094-1|AAI25095.1| 725|Homo sapiens AFAP1L1 protein protein. 31 2.4 BC125093-1|AAI25094.1| 768|Homo sapiens actin filament associat... 31 2.4 BC040723-1|AAH40723.1| 377|Homo sapiens AFAP1L1 protein protein. 31 2.4 AK095980-1|BAC04664.1| 624|Homo sapiens protein ( Homo sapiens ... 31 2.4 AK074185-1|BAB85011.1| 792|Homo sapiens FLJ00258 protein protein. 31 2.4 >BC125094-1|AAI25095.1| 725|Homo sapiens AFAP1L1 protein protein. Length = 725 Score = 31.5 bits (68), Expect = 2.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 500 HEEYSERTEEDADPQPRHQEPRGQ-KRYLFEHC 405 +E Y E EE PQPRHQ P + +L C Sbjct: 189 YESYDEEEEEGKSPQPRHQWPSEEASMHLVREC 221 >BC125093-1|AAI25094.1| 768|Homo sapiens actin filament associated protein 1-like 1 protein. Length = 768 Score = 31.5 bits (68), Expect = 2.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 500 HEEYSERTEEDADPQPRHQEPRGQ-KRYLFEHC 405 +E Y E EE PQPRHQ P + +L C Sbjct: 189 YESYDEEEEEGKSPQPRHQWPSEEASMHLVREC 221 >BC040723-1|AAH40723.1| 377|Homo sapiens AFAP1L1 protein protein. Length = 377 Score = 31.5 bits (68), Expect = 2.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 500 HEEYSERTEEDADPQPRHQEPRGQ-KRYLFEHC 405 +E Y E EE PQPRHQ P + +L C Sbjct: 189 YESYDEEEEEGKSPQPRHQWPSEEASMHLVREC 221 >AK095980-1|BAC04664.1| 624|Homo sapiens protein ( Homo sapiens cDNA FLJ38661 fis, clone HLUNG2001633, weakly similar to Homo sapiens actin filament associated protein (AFAP) mRNA. ). Length = 624 Score = 31.5 bits (68), Expect = 2.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 500 HEEYSERTEEDADPQPRHQEPRGQ-KRYLFEHC 405 +E Y E EE PQPRHQ P + +L C Sbjct: 189 YESYDEEEEEGKSPQPRHQWPSEEASMHLVREC 221 >AK074185-1|BAB85011.1| 792|Homo sapiens FLJ00258 protein protein. Length = 792 Score = 31.5 bits (68), Expect = 2.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 500 HEEYSERTEEDADPQPRHQEPRGQ-KRYLFEHC 405 +E Y E EE PQPRHQ P + +L C Sbjct: 213 YESYDEEEEEGKSPQPRHQWPSEEASMHLVREC 245 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,499,222 Number of Sequences: 237096 Number of extensions: 1549476 Number of successful extensions: 3106 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3106 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6579110070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -