BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a18 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14261| Best HMM Match : ig (HMM E-Value=0) 39 0.004 SB_54662| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_30290| Best HMM Match : I-set (HMM E-Value=1.4e-21) 36 0.036 SB_27122| Best HMM Match : I-set (HMM E-Value=1.9e-39) 36 0.036 SB_21023| Best HMM Match : I-set (HMM E-Value=2e-07) 36 0.036 SB_13651| Best HMM Match : I-set (HMM E-Value=4e-17) 36 0.036 SB_50677| Best HMM Match : I-set (HMM E-Value=6.7e-11) 36 0.036 SB_14313| Best HMM Match : I-set (HMM E-Value=1.8e-21) 36 0.036 SB_10041| Best HMM Match : ig (HMM E-Value=3.5e-06) 35 0.048 SB_38293| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_50998| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_11246| Best HMM Match : ig (HMM E-Value=7.5e-07) 35 0.063 SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.083 SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.083 SB_16914| Best HMM Match : I-set (HMM E-Value=2.3e-10) 34 0.083 SB_3251| Best HMM Match : I-set (HMM E-Value=1.8e-07) 34 0.083 SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_56444| Best HMM Match : fn3 (HMM E-Value=1.2e-21) 34 0.11 SB_31858| Best HMM Match : I-set (HMM E-Value=3.7e-08) 34 0.11 SB_59087| Best HMM Match : ig (HMM E-Value=1.5e-27) 33 0.15 SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_17403| Best HMM Match : I-set (HMM E-Value=0) 33 0.15 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) 33 0.19 SB_43033| Best HMM Match : I-set (HMM E-Value=3.3e-18) 33 0.25 SB_8818| Best HMM Match : I-set (HMM E-Value=0) 32 0.34 SB_2143| Best HMM Match : ig (HMM E-Value=1.9e-09) 32 0.45 SB_47306| Best HMM Match : I-set (HMM E-Value=0) 32 0.45 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 31 0.59 SB_11883| Best HMM Match : I-set (HMM E-Value=0) 31 0.59 SB_47305| Best HMM Match : I-set (HMM E-Value=0) 31 0.59 SB_19559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_50799| Best HMM Match : I-set (HMM E-Value=0) 31 0.78 SB_58036| Best HMM Match : Cadherin (HMM E-Value=0) 31 0.78 SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_27603| Best HMM Match : ig (HMM E-Value=2.9e-10) 31 0.78 SB_22798| Best HMM Match : Cadherin (HMM E-Value=0) 31 0.78 SB_49916| Best HMM Match : ig (HMM E-Value=8.5e-06) 31 1.0 SB_51089| Best HMM Match : I-set (HMM E-Value=1.4e-38) 31 1.0 SB_26428| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_24472| Best HMM Match : I-set (HMM E-Value=0) 31 1.0 SB_35648| Best HMM Match : I-set (HMM E-Value=8.5e-05) 30 1.4 SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) 30 1.4 SB_10606| Best HMM Match : I-set (HMM E-Value=0) 30 1.4 SB_26427| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 1.8 SB_58150| Best HMM Match : ig (HMM E-Value=3.7e-24) 30 1.8 SB_24015| Best HMM Match : I-set (HMM E-Value=2.7e-21) 30 1.8 SB_23359| Best HMM Match : I-set (HMM E-Value=0) 30 1.8 SB_59628| Best HMM Match : I-set (HMM E-Value=5e-21) 30 1.8 SB_37708| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29237| Best HMM Match : I-set (HMM E-Value=0) 30 1.8 SB_7588| Best HMM Match : DcpS (HMM E-Value=0) 30 1.8 SB_6364| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 29 2.4 SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_34975| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 2.4 SB_19226| Best HMM Match : I-set (HMM E-Value=0) 29 2.4 SB_10900| Best HMM Match : I-set (HMM E-Value=0) 29 2.4 SB_57926| Best HMM Match : I-set (HMM E-Value=3.5e-39) 29 2.4 SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.4 SB_8819| Best HMM Match : I-set (HMM E-Value=0) 29 2.4 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 29 2.4 SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_45852| Best HMM Match : I-set (HMM E-Value=0) 29 3.1 SB_36876| Best HMM Match : ig (HMM E-Value=2.9e-26) 29 3.1 SB_32327| Best HMM Match : ig (HMM E-Value=7.9e-23) 29 3.1 SB_30292| Best HMM Match : fn3 (HMM E-Value=1.2e-12) 29 3.1 SB_18596| Best HMM Match : ig (HMM E-Value=0.033) 29 3.1 SB_9202| Best HMM Match : ig (HMM E-Value=5e-40) 29 3.1 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_24929| Best HMM Match : ig (HMM E-Value=8.2e-06) 29 3.1 SB_13005| Best HMM Match : PSI (HMM E-Value=2.9e-11) 29 3.1 SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_45516| Best HMM Match : I-set (HMM E-Value=1.1e-26) 29 4.1 SB_38860| Best HMM Match : GRP (HMM E-Value=0.47) 29 4.1 SB_37927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_46724| Best HMM Match : I-set (HMM E-Value=6.1e-11) 29 4.1 SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) 29 4.1 SB_31893| Best HMM Match : I-set (HMM E-Value=2e-22) 29 4.1 SB_57324| Best HMM Match : ig (HMM E-Value=1e-26) 28 5.5 SB_30961| Best HMM Match : I-set (HMM E-Value=0) 28 5.5 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_54071| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) 28 5.5 SB_9034| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_1442| Best HMM Match : SRCR (HMM E-Value=0) 28 5.5 SB_55607| Best HMM Match : ig (HMM E-Value=4.6e-17) 28 7.2 SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 28 7.2 SB_10883| Best HMM Match : ig (HMM E-Value=7.00649e-43) 28 7.2 SB_51604| Best HMM Match : I-set (HMM E-Value=2.3e-21) 28 7.2 SB_44087| Best HMM Match : I-set (HMM E-Value=1.5e-05) 28 7.2 SB_43971| Best HMM Match : I-set (HMM E-Value=1.7e-09) 28 7.2 SB_43084| Best HMM Match : ig (HMM E-Value=9.7e-23) 28 7.2 SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 7.2 SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_29125| Best HMM Match : I-set (HMM E-Value=1.8e-09) 28 7.2 SB_16652| Best HMM Match : I-set (HMM E-Value=1.2e-37) 28 7.2 SB_11355| Best HMM Match : I-set (HMM E-Value=1.5e-05) 28 7.2 SB_53160| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_48846| Best HMM Match : Pkinase_Tyr (HMM E-Value=8.1e-16) 27 9.6 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 27 9.6 SB_30807| Best HMM Match : I-set (HMM E-Value=7.8e-08) 27 9.6 SB_28589| Best HMM Match : ig (HMM E-Value=1.1e-05) 27 9.6 SB_20377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_16822| Best HMM Match : I-set (HMM E-Value=1.3e-07) 27 9.6 SB_8401| Best HMM Match : ig (HMM E-Value=8.1e-22) 27 9.6 SB_58211| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 9.6 SB_41624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_18843| Best HMM Match : I-set (HMM E-Value=1e-07) 27 9.6 SB_18521| Best HMM Match : ig (HMM E-Value=7.5e-11) 27 9.6 SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39) 27 9.6 SB_5575| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_14261| Best HMM Match : ig (HMM E-Value=0) Length = 1337 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 SI Q P + T G + EL C A+GSP+P+V W+K Sbjct: 696 SIVQFPSKNIILTEGDSKELMCNASGSPSPAVTWYK 731 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS T + LTC A G+P P+ W + Sbjct: 11 PSPTVTERDQVNLTCSADGTPPPTFTWIR 39 >SB_54662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 525 SITQGPLPSYA-HTPGTTIELTCEAAGSPAPSVHWFK 632 +IT+ P P G T++LTC A GSP P++ W K Sbjct: 189 TITKSPPPVVTVQRRGATLQLTCAAQGSPTPTIEWSK 225 >SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 100 PIQNTTVRAGETITLTCAVAGNPTPSVSWSK 130 >SB_30290| Best HMM Match : I-set (HMM E-Value=1.4e-21) Length = 250 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 170 PIQNTTVRAGETITLTCAVAGNPTPSVSWSK 200 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHW 626 + +TC A+G PAP+V W Sbjct: 94 VTVTCSASGRPAPNVTW 110 >SB_27122| Best HMM Match : I-set (HMM E-Value=1.9e-39) Length = 378 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 124 PIQNTTIRAGETITLTCAVAGNPTPSVSWSK 154 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC A+G PAP+V W Sbjct: 30 ITCSASGHPAPNVTW 44 >SB_21023| Best HMM Match : I-set (HMM E-Value=2e-07) Length = 175 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 39 PIQNTTVRAGETITLTCAVAGNPTPSVFWSK 69 >SB_13651| Best HMM Match : I-set (HMM E-Value=4e-17) Length = 333 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 253 PIQNTTVRAGETITLTCAVAGNPTPSVSWSK 283 >SB_50677| Best HMM Match : I-set (HMM E-Value=6.7e-11) Length = 87 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 7 PIQNTTIRAGETITLTCAVAGNPTPSVSWSK 37 >SB_14313| Best HMM Match : I-set (HMM E-Value=1.8e-21) Length = 221 Score = 35.5 bits (78), Expect = 0.036 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 130 PIQNTTVRAGETITLTCAVAGNPTPSVSWSK 160 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC A+G PAP+V W Sbjct: 56 ITCSASGRPAPNVTW 70 >SB_10041| Best HMM Match : ig (HMM E-Value=3.5e-06) Length = 333 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 294 PMHNTTVRAGETITLTCTVAGNPTPSVSWSK 324 Score = 27.5 bits (58), Expect = 9.6 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +3 Query: 417 SCQSAH-LNKHIKLLS--DIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELT 587 +CQ AH L+ H + L+ ++ +A S + + S+ +T Sbjct: 162 TCQLAHSLHLHSRKLALLPVNQQALPSEKAIPVTSRQRKRLNNNTATSHDVAEHDDFNVT 221 Query: 588 CEAAGSPAPSVHW 626 C A+G PAP+V W Sbjct: 222 CSASGRPAPNVTW 234 >SB_38293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1732 Score = 35.1 bits (77), Expect = 0.048 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 534 QGP--LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 QGP S A G T+ L C A+G PAP++ W+K Sbjct: 1300 QGPKAASSIALLEGETLTLNCTASGCPAPNITWYK 1334 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 579 ELTCEAAGSPAPSVHW 626 EL+C A G+P P+V W Sbjct: 164 ELSCSATGNPTPNVTW 179 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G ++ L C A G P P++ W K Sbjct: 692 GESLTLNCTATGCPTPNITWTK 713 >SB_50998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.7 bits (76), Expect = 0.063 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG+P PSV W K Sbjct: 76 PIQNTTVRAGETITLTCVLAGNPTPSVSWSK 106 >SB_11246| Best HMM Match : ig (HMM E-Value=7.5e-07) Length = 80 Score = 34.7 bits (76), Expect = 0.063 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G TI LTC AG+P PSV W K Sbjct: 9 GETITLTCAVAGNPTPSVSWSK 30 >SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6119 Score = 34.3 bits (75), Expect = 0.083 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 516 KYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +++ +GP+ + T G + LTC +G P PS+ W+K Sbjct: 202 EFIDEERGPIDA---TTGDEVTLTCSVSGKPKPSITWYK 237 Score = 32.3 bits (70), Expect = 0.34 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ L C +G PAP++ W+K Sbjct: 1682 GGTVTLECTVSGKPAPNIEWYK 1703 Score = 31.9 bits (69), Expect = 0.45 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL S G +L C +GSP+P+V W K Sbjct: 1099 PLESVEVNEGEDFDLECVVSGSPSPTVEWTK 1129 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 516 KYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +++ +GP+ T G +ELT G P P + WFK Sbjct: 1569 EFMDKAEGPIEK---TEGDDLELTVRVRGKPQPELEWFK 1604 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+T L C GSP P V W++ Sbjct: 3993 GSTARLECRIVGSPVPEVRWYR 4014 Score = 30.3 bits (65), Expect = 1.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G++ +L C G+P P++ W+K Sbjct: 2861 GSSFKLRCRVTGTPTPTIEWYK 2882 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G I+L + G PAP+V WFK Sbjct: 3641 GAPIKLIVQIKGKPAPTVEWFK 3662 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ G ++EL G PAP + W K Sbjct: 500 SFTVVEGESVELVARVTGKPAPEIEWTK 527 Score = 28.7 bits (61), Expect = 4.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +L C+ G PAP++ W K Sbjct: 313 GEESKLVCKVTGKPAPTIEWLK 334 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G I LTC +G+P P+ WF+ Sbjct: 5980 GGKITLTCLISGNPVPTATWFR 6001 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 SY G TI L G+P P + W+K Sbjct: 3049 SYELQEGDTITLDAVVKGNPYPEIRWYK 3076 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G L+C +G P P++ W K Sbjct: 603 TEGDDAVLSCTISGKPVPTIEWLK 626 Score = 27.5 bits (58), Expect = 9.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G I++ C +G P P++ W K Sbjct: 2565 GEAIKMECRVSGKPEPTITWLK 2586 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL G TI L C +P P V W K Sbjct: 3436 PLHDQEVVEGETIRLECRVRATPRPMVEWKK 3466 >SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1496 Score = 34.3 bits (75), Expect = 0.083 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +3 Query: 456 LSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTP-GTTIELTCEAAGSPAPSVHWF 629 L I +S+ + G++K+ L S A G+T+ + C A GSP PSV W+ Sbjct: 1134 LDPIISSVAPDIPGHWQGANKFTRPRVDKLDSLATVVRGSTLRIRCAAYGSPKPSVTWY 1192 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 522 LSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 LSIT G + + G TI + CE G P P++ W++ Sbjct: 619 LSITTGAIVTIPR--GVTITIRCEVTGKPEPNITWYR 653 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ + C A G P P V W K Sbjct: 193 GVTVSIECNATGVPRPEVFWSK 214 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 +T+ +TC G P P + WFK Sbjct: 527 STVVITCPTEGFPKPIISWFK 547 >SB_16914| Best HMM Match : I-set (HMM E-Value=2.3e-10) Length = 94 Score = 34.3 bits (75), Expect = 0.083 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ + G TI LTC AG P PSV W K Sbjct: 7 PIQNTTVRAGETITLTCAVAGYPTPSVSWSK 37 >SB_3251| Best HMM Match : I-set (HMM E-Value=1.8e-07) Length = 147 Score = 34.3 bits (75), Expect = 0.083 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 528 ITQGPLPSYAHTP-GTTIELTCEAAGSPAPSVHWFK 632 IT P HT G T+ L C+A G PAP+ W+K Sbjct: 55 ITSQPEYPEVHTVLGGTLRLYCDALGDPAPTFQWYK 90 >SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 522 LSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 LSIT + T+EL CE GSP P++ W K Sbjct: 677 LSITSPANKTIIVLENNTVELVCETTGSPPPNITWTK 713 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC+A+G+P PS+ W Sbjct: 1307 ITCQASGNPRPSITW 1321 >SB_56444| Best HMM Match : fn3 (HMM E-Value=1.2e-21) Length = 651 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 543 LPSYAH-TPGTTIELTCEAAGSPAPSVHWF 629 L S+ H T T I +TC A+G PAP+V W+ Sbjct: 232 LRSFYHVTENTNISVTCLASGRPAPNVTWY 261 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L C A GSP P + W+K Sbjct: 359 GRLLSLQCTARGSPYPYITWYK 380 >SB_31858| Best HMM Match : I-set (HMM E-Value=3.7e-08) Length = 229 Score = 33.9 bits (74), Expect = 0.11 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHW 626 T+ LTC+A G+PAP V+W Sbjct: 166 TVRLTCQATGNPAPDVYW 183 >SB_59087| Best HMM Match : ig (HMM E-Value=1.5e-27) Length = 955 Score = 33.5 bits (73), Expect = 0.15 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GTT+ TC + G+PAP + W+K Sbjct: 673 GTTLNQTCVSQGNPAPVIQWYK 694 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 564 PGTTIELTCEAAGSPAPSVHWFK 632 P T+ + C A G P P + WFK Sbjct: 241 PDTSQDFHCAATGFPLPEIRWFK 263 >SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 33.5 bits (73), Expect = 0.15 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 564 PGTTIELTCEAAGSPAPSVHW 626 PG ++EL C A G PAP++ W Sbjct: 1310 PGVSLELKCSAQGLPAPTIRW 1330 Score = 30.7 bits (66), Expect = 1.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWF 629 GTT+ + C G P P+V+W+ Sbjct: 483 GTTLTIKCPVMGKPTPTVYWY 503 >SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 33.5 bits (73), Expect = 0.15 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GTT+ TC + G+PAP + W+K Sbjct: 149 GTTLNQTCVSQGNPAPVIQWYK 170 >SB_17403| Best HMM Match : I-set (HMM E-Value=0) Length = 671 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T T+EL C A G+PAP++ W K Sbjct: 341 TENQTLELYCNATGNPAPAIRWSK 364 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 33.1 bits (72), Expect = 0.19 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I+ P P T G + L+C A G P PS WFK Sbjct: 1140 ISTHPSPQTV-TEGENVTLSCAAEGRPTPSYQWFK 1173 Score = 31.9 bits (69), Expect = 0.45 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I+ P P T G + L C A G P PS WFK Sbjct: 956 ISTHPSPQTV-TEGQNVTLLCVAEGRPTPSYQWFK 989 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G + L C A G P+PS WFK Sbjct: 1058 TEGENVTLLCVAEGRPSPSYQWFK 1081 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G I L CEA G+P P+ W K Sbjct: 2575 GKQISLVCEAGGNPIPTFSWLK 2596 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G ++ C+ G+P+P+V W K Sbjct: 784 TEGQVVKFECQTTGNPSPNVTWLK 807 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 468 DNSIENGVQAKSDGSHKYL-SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +NS+ N +K + + SIT P + G + L+C G P P+V+W Sbjct: 1211 NNSVSNVTSSKVQLTVFFAPSITTHP-QNQTKVEGEIVTLSCTVTGDPVPTVYW 1263 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 522 LSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 LSI P P T G + TC A APS+ W K Sbjct: 594 LSIVTHPQPKSVFT-GDDVTFTCNATALAAPSIWWQK 629 >SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 2064 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 564 PGTTIELTCEAAGSPAPSVHW 626 P T +EL C A GSP PS+ W Sbjct: 283 PDTDVELKCSARGSPTPSIVW 303 Score = 31.5 bits (68), Expect = 0.59 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + TC A G+P P++ WFK Sbjct: 185 GDDVTFTCAAVGTPTPNITWFK 206 >SB_43033| Best HMM Match : I-set (HMM E-Value=3.3e-18) Length = 93 Score = 32.7 bits (71), Expect = 0.25 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I+ P P T G + L+C A G P PS WFK Sbjct: 5 ISTHPSPQTV-TEGENVTLSCVAEGRPTPSYQWFK 38 >SB_8818| Best HMM Match : I-set (HMM E-Value=0) Length = 2787 Score = 32.3 bits (70), Expect = 0.34 Identities = 20/59 (33%), Positives = 26/59 (44%) Frame = +3 Query: 456 LSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +S + SI V AK IT+ L G + LTC+ G+PAP WFK Sbjct: 610 ISQVIGSIRFIVLAKKPAGEAP-EITES-LQEMEELEGNPVTLTCKFTGTPAPVAEWFK 666 Score = 31.5 bits (68), Expect = 0.59 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +L C+ GSP P+V WFK Sbjct: 1104 GDEAKLVCKITGSPTPTVEWFK 1125 Score = 29.5 bits (63), Expect = 2.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +L C+ +G P P++ WFK Sbjct: 937 GEDAKLECKVSGEPQPTIEWFK 958 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +L C+ +G P P + W K Sbjct: 1393 TAGEDTKLVCKISGKPQPKIDWMK 1416 >SB_2143| Best HMM Match : ig (HMM E-Value=1.9e-09) Length = 306 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +3 Query: 477 IENGVQAKSDGSHKYLSITQGPLPSYAH---TPGTTIELTCEAAGSPAPSVHW 626 +++G + + S L + P ++A+ T ELTC A G+P P+V W Sbjct: 101 VDDGGETTFEASKFTLDVLVPPSVTHANITVNKTNTAELTCSATGNPTPNVTW 153 >SB_47306| Best HMM Match : I-set (HMM E-Value=0) Length = 1260 Score = 31.9 bits (69), Expect = 0.45 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL S G T L C+A G P P+V W K Sbjct: 141 PLKSLEVPEGATATLECKATGIPTPTVEWRK 171 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +TCE G P PSV W K Sbjct: 1072 GEDAVMTCEVTGKPEPSVEWLK 1093 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L C +G P P+V W K Sbjct: 442 GEDVMLACAVSGKPEPTVEWLK 463 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + + + G TI L C G P P V WFK Sbjct: 2402 LTNVSISSGDTIVLECRVTGKPRPQVAWFK 2431 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G T C G P PS+ WFK Sbjct: 3365 TEGQTATFECTVKGYPRPSIEWFK 3388 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ L GSP P V WFK Sbjct: 2214 GNTVTLRIHVTGSPKPEVDWFK 2235 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHW 626 + SY T G ++LT + G P P+V W Sbjct: 4297 ISSYEFTSGGDVKLTVKVTGRPYPTVTW 4324 >SB_11883| Best HMM Match : I-set (HMM E-Value=0) Length = 616 Score = 31.5 bits (68), Expect = 0.59 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ L C A G P+P + W+K Sbjct: 439 GNTVSLLCNATGVPSPKLSWYK 460 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + LTC+A G P P+V W K Sbjct: 24 VTLTCKATGLPLPTVRWIK 42 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 + +E+TC G P PS+ W K Sbjct: 542 SNVEVTCPVRGFPLPSITWLK 562 >SB_47305| Best HMM Match : I-set (HMM E-Value=0) Length = 5832 Score = 31.5 bits (68), Expect = 0.59 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + +LTC+ G P P+V WFK Sbjct: 3701 GDSAKLTCKMFGKPEPTVEWFK 3722 Score = 31.5 bits (68), Expect = 0.59 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWF 629 T + E CE +GSPAP + WF Sbjct: 4467 TEDESAEFRCEVSGSPAPRIQWF 4489 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +L+C G P P V WF+ Sbjct: 1033 TEGDDFQLSCNVTGRPQPEVQWFR 1056 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/83 (24%), Positives = 37/83 (44%) Frame = +3 Query: 378 HLVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYA 557 HL++LFT + G+ +K L + + +QA + + K + + LP A Sbjct: 5206 HLIILFTKSEHAGTYSCEATSK----LGNTSAKFDVQIQAP-EAAPKAPAFLKQLLPQNA 5260 Query: 558 HTPGTTIELTCEAAGSPAPSVHW 626 G ++ +C+ G P P + W Sbjct: 5261 RE-GDVVKFSCKVTGYPEPEIEW 5282 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G LTC+ +G P P++ W K Sbjct: 1327 TEGDDCRLTCKVSGYPEPTLEWLK 1350 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G + C+ AG P P+V W++ Sbjct: 2204 TEGDNVSWMCKVAGMPRPTVEWYR 2227 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +L C G P P V WFK Sbjct: 744 GEDCKLICHVTGEPNPEVEWFK 765 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G + L E G+P P V WFK Sbjct: 4765 TEGESTALEVEITGTPLPKVEWFK 4788 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T EL C+ G+P PS W K Sbjct: 1620 TESDDFELACDVKGTPDPSYEWLK 1643 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + + G PAP+V WFK Sbjct: 3895 GCEVSMMANVRGKPAPTVEWFK 3916 >SB_19559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 31.5 bits (68), Expect = 0.59 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 IT+ P+ S G +ELTC A G P P W K Sbjct: 138 ITEQPM-SLPVQEGLKLELTCRATGFPPPQYQWVK 171 >SB_50799| Best HMM Match : I-set (HMM E-Value=0) Length = 1195 Score = 31.1 bits (67), Expect = 0.78 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 T+ LTC A G PAP V+W + Sbjct: 459 TLNLTCVALGDPAPRVYWVR 478 Score = 29.1 bits (62), Expect = 3.1 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G+ ++L+C+A+G P P W Sbjct: 746 GSNVQLSCQASGDPTPKYKW 765 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 540 PLPSYA-HTPGTTIELTCEAAGSPAPSVHWF 629 PLP G + LTC A G P P+V W+ Sbjct: 828 PLPEKVIFMEGQPLNLTCAAEGIPLPNVTWY 858 >SB_58036| Best HMM Match : Cadherin (HMM E-Value=0) Length = 6074 Score = 31.1 bits (67), Expect = 0.78 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 465 IDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTP-GTTIELTCEAAGSPAPSVHWFK 632 I +E+ +S G ++T+ P Y T GT++ TCEA G P W K Sbjct: 995 ISEEVESPALCESSGP----TLTREISPKYLRTRVGTSVTWTCEAIGGVTPVYQWLK 1047 >SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 31.1 bits (67), Expect = 0.78 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +ITQ P S G TI LTC + G P+P + W Sbjct: 261 TITQPP-KSLITIAGETIFLTCSSEGLPSPKIDW 293 >SB_27603| Best HMM Match : ig (HMM E-Value=2.9e-10) Length = 135 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 540 PLPS-YAHTPGTTIELTCEAAGSPAPSVHWFK 632 PLP+ + G+ LTC A G+P P V+W K Sbjct: 7 PLPNNVTYFEGSEAVLTCSAEGTPFPIVYWSK 38 >SB_22798| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3255 Score = 31.1 bits (67), Expect = 0.78 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 IT P S GT L C A+G P PS WFK Sbjct: 2410 ITHHPEDSSVELGGTAT-LECRASGVPEPSYRWFK 2443 >SB_49916| Best HMM Match : ig (HMM E-Value=8.5e-06) Length = 465 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +I L C A+G+PAP V W K Sbjct: 19 GDSISLDCTASGTPAPKVTWRK 40 >SB_51089| Best HMM Match : I-set (HMM E-Value=1.4e-38) Length = 1334 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G T+ L CEA GSP P V W Sbjct: 1088 GQTLLLDCEAKGSPQPEVKW 1107 >SB_26428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +I L C A+G+PAP V W K Sbjct: 896 GESISLDCTASGTPAPKVTWRK 917 >SB_24472| Best HMM Match : I-set (HMM E-Value=0) Length = 473 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+T L C A G PAP++ W K Sbjct: 300 GSTASLQCRAGGHPAPAIAWTK 321 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 SIT P G T+ + C A G+P P + W K Sbjct: 379 SITDKPRDQNVRA-GQTVNIFCVAVGAPDPVITWIK 413 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +T+ P G ++ L C A G P P++ W K Sbjct: 196 LTRYPRAQVDTLEGNSVTLQCRAQGRPNPTIAWAK 230 >SB_35648| Best HMM Match : I-set (HMM E-Value=8.5e-05) Length = 181 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 9/46 (19%) Frame = +3 Query: 519 YLSITQGPLPSYAHTP---------GTTIELTCEAAGSPAPSVHWF 629 +L ++QG P + TP T+ LTC A G P+P V W+ Sbjct: 85 FLVVSQGVKPMFYATPDRPWLAIERSKTLPLTCGAMGVPSPIVEWY 130 >SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) Length = 1931 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +IT P P G + L+C A +P P+ +W K Sbjct: 1398 AITTHPQPLTETAAGKPLRLSCAAVATPMPAYYWVK 1433 >SB_10606| Best HMM Match : I-set (HMM E-Value=0) Length = 872 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+T+ + C A G PAP V W K Sbjct: 140 GSTLRIRCSANGLPAPEVKWSK 161 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T + L C+A G+P PSV W K Sbjct: 799 TQVTLRCQATGTPMPSVIWSK 819 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHW 626 +TI + C A G PAP V W Sbjct: 467 STIRIVCNATGLPAPRVTW 485 Score = 27.5 bits (58), Expect = 9.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 GT++ + C G PAP++ W Sbjct: 35 GTSVSIKCPVQGIPAPAITW 54 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I L C GSP P V W K Sbjct: 246 TSITLKCPVTGSPKPLVDWSK 266 >SB_26427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 25.4 bits (53), Expect(2) = 1.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHW 626 ++LTC + G PAP+V W Sbjct: 190 LKLTCISDGYPAPTVTW 206 Score = 23.0 bits (47), Expect(2) = 1.8 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = +3 Query: 315 EGALEFFLRESHQYYRAVVRMHLVLLFTVAALLGSCQSAHLNKHIKLL 458 EG+ + +RE+ Y + R L+++ +++ + S +N+ I L Sbjct: 143 EGSYKVSIRENIDLYTDIERSGLLIVLDKPSIISNSPSQTVNETIDFL 190 >SB_58150| Best HMM Match : ig (HMM E-Value=3.7e-24) Length = 456 Score = 29.9 bits (64), Expect = 1.8 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 5/78 (6%) Frame = +3 Query: 411 LGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIE--- 581 +GS S +KLL + G + S S +Q P+ + A TTI Sbjct: 328 IGSTISVLAGSRLKLLCPVTEPF--GPKINSTRSVIIQLDSQAPITTMAGATLTTISGVD 385 Query: 582 --LTCEAAGSPAPSVHWF 629 + C+A G P P V WF Sbjct: 386 LTINCQATGLPVPDVAWF 403 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHW 626 TTI + C+A+G PAP W Sbjct: 259 TTITIRCQASGDPAPDTAW 277 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHW 626 T I L C+A G P PSV W Sbjct: 147 TNITLVCKARGLPKPSVSW 165 >SB_24015| Best HMM Match : I-set (HMM E-Value=2.7e-21) Length = 609 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P+P A PG + C A G P P++ W Sbjct: 149 PVPVEADEPGKPVLFKCSADGYPNPTISW 177 >SB_23359| Best HMM Match : I-set (HMM E-Value=0) Length = 367 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +T P + G +EL C G P PS+ W Sbjct: 102 VTVSPSRQHYVATGRQVELLCTVTGYPVPSIEW 134 >SB_59628| Best HMM Match : I-set (HMM E-Value=5e-21) Length = 209 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G++I LTC A G P P+V W K Sbjct: 28 GSSITLTCTAEGLPVPAVVWKK 49 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWF 629 G +EL C + G+P P+V WF Sbjct: 134 GKDLELQCPSIGTPKPAVTWF 154 >SB_37708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 29.9 bits (64), Expect = 1.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+ + LTCE G P P++ W K Sbjct: 1706 GSRVTLTCEVRGIPTPNITWSK 1727 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + LTCE G P P++ W K Sbjct: 1793 GNRLTLTCEVQGIPTPNITWSK 1814 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = +3 Query: 516 KYLSITQGPLPSYA--HTP--GTTIELTCEAAGSPAPSVHWFK 632 +Y + + L SY HT GT++ L C G P P + W K Sbjct: 1349 RYFFLGKPTLLSYPSNHTVRNGTSVRLECHVKGKPTPIITWTK 1391 >SB_29237| Best HMM Match : I-set (HMM E-Value=0) Length = 869 Score = 29.9 bits (64), Expect = 1.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWF 629 G TI L C A G+P P + W+ Sbjct: 241 GDTITLYCSATGTPKPDISWY 261 >SB_7588| Best HMM Match : DcpS (HMM E-Value=0) Length = 446 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = +3 Query: 441 KHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSV 620 +HI LL +I N + ++ K + H L I PSY H L +A GS + Sbjct: 344 EHIPLLKNILNKGRDAIRTKYNVPHSQLRIYVHYQPSYYHFHVHFTHLKFDAPGSGSGKA 403 Query: 621 H 623 H Sbjct: 404 H 404 >SB_6364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L+C A+G PAP + W++ Sbjct: 126 GNNVTLSCNASGIPAPVITWYR 147 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 29.5 bits (63), Expect = 2.4 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 4/74 (5%) Frame = -1 Query: 614 WCWRSGSFAGQLNSGSGSMCVRR*G--ALRDR*IFMRSIRFCLHTI--LNTVIDVRKQLN 447 WC +G+F GS CV R G R + C HT + ++ V K Sbjct: 413 WCNYNGNFREVQCHGSFCFCVNRDGQEIQGTRTYSYTGLPRCTHTAPDIGLLLFVPKMTR 472 Query: 446 VFIQMGGLARAQQR 405 V ++ G L R QQ+ Sbjct: 473 VMLEGGSLTRCQQK 486 >SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +3 Query: 441 KHIKLLSDIDNSIENGV-QAKSDGSHKYLS 527 +H+KL+S++ NS+ N + +AK G HK ++ Sbjct: 319 EHLKLMSELGNSLINSIYEAKIAGDHKKIN 348 >SB_34975| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 909 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 TI LTC G P P+V+W K Sbjct: 691 TINLTCLVRGDPTPAVYWKK 710 >SB_19226| Best HMM Match : I-set (HMM E-Value=0) Length = 1500 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C AAGSP P W K Sbjct: 488 GETAVLQCTAAGSPTPYFRWLK 509 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 564 PGTTIELTCEAAGSPAP-SVHWF 629 PGT +++TCE + P P V W+ Sbjct: 669 PGTPLQITCEVSAIPYPRDVQWY 691 >SB_10900| Best HMM Match : I-set (HMM E-Value=0) Length = 1642 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +3 Query: 519 YLSITQGP----LPSYAH-TPGTTIELTCEAAGSPAPSVHWFK 632 YL+I+ P LPS+ G I L C A + AP + WFK Sbjct: 560 YLTISDVPVFVQLPSHQTLVKGNAITLPCRATAADAPVITWFK 602 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 531 TQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 T+ + + +T +TC+ G+PAP+V W+ Sbjct: 744 TRAVVTDFTMETSSTDLVTCDVTGTPAPTVTWY 776 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 ITQGP + H G C A +P+PSV W Sbjct: 120 ITQGPTGTSPHV-GQEAIFHCIATANPSPSVSW 151 Score = 27.5 bits (58), Expect = 9.6 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 14/74 (18%) Frame = +3 Query: 453 LLSDI---DNSIENGVQAKSDGSHK---YLSITQGPL-PSYAHTP-------GTTIELTC 590 ++SD+ D + + S GS K L++ P PS+ TP G+ I C Sbjct: 174 VISDVKKADTGYYTCIVSNSFGSAKAFAQLTVLDAPAAPSFTTTPTNQTAREGSDITFYC 233 Query: 591 EAAGSPAPSVHWFK 632 A+G P P++ W K Sbjct: 234 MASGVPTPTITWHK 247 >SB_57926| Best HMM Match : I-set (HMM E-Value=3.5e-39) Length = 788 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G T+ C+ G+P P+V W+K Sbjct: 337 TIGETVVFDCQTRGNPTPTVTWWK 360 >SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 869 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+ EL C+A G P P + W+K Sbjct: 48 GSKAELICDATGYPQPVIAWYK 69 >SB_8819| Best HMM Match : I-set (HMM E-Value=0) Length = 1789 Score = 29.5 bits (63), Expect = 2.4 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 579 ELTCEAAGSPAPSVHWFK 632 +LTC+ +G P P++ WFK Sbjct: 1055 KLTCKVSGLPEPTIKWFK 1072 Score = 29.5 bits (63), Expect = 2.4 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 579 ELTCEAAGSPAPSVHWFK 632 +LTC+ +G P P++ WFK Sbjct: 1344 KLTCKVSGLPEPTIKWFK 1361 >SB_8817| Best HMM Match : I-set (HMM E-Value=0) Length = 2526 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 I++T + G P PSV WFK Sbjct: 462 IKMTAQVTGKPQPSVEWFK 480 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 I+LT + G P PSV W K Sbjct: 88 IKLTVQVTGKPQPSVEWLK 106 >SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 P+ S +TI L C G PAP V W K Sbjct: 842 PMSSLTAAYNSTIRLECFTDGRPAPKVTWSK 872 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWF 629 G +EL C + G+P P+V WF Sbjct: 368 GKDLELQCPSIGTPKPAVTWF 388 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G T+ L C+A G P P++ W Sbjct: 904 GVTVTLVCQAIGLPVPTITW 923 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G++I LTC A G P P V W K Sbjct: 262 GSSITLTCTAEGLPVPFVVWKK 283 >SB_36876| Best HMM Match : ig (HMM E-Value=2.9e-26) Length = 1128 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 Y S++ P + + G+ +++TC A+ S++W K Sbjct: 623 YSSVSIAPARTITTSEGSYVQMTCSASAVDLSSINWIK 660 >SB_32327| Best HMM Match : ig (HMM E-Value=7.9e-23) Length = 932 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 + + L+C+A G+P+P V W K Sbjct: 640 SVVSLSCDATGNPSPRVQWRK 660 >SB_30292| Best HMM Match : fn3 (HMM E-Value=1.2e-12) Length = 519 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L C+A G P+P + W+K Sbjct: 381 GKVLSLQCKARGLPSPQITWYK 402 >SB_18596| Best HMM Match : ig (HMM E-Value=0.033) Length = 192 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L C+A G P+P + W+K Sbjct: 8 GKVLSLQCKARGLPSPQITWYK 29 >SB_9202| Best HMM Match : ig (HMM E-Value=5e-40) Length = 1604 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 +T P T T TC A G PAP + WF Sbjct: 618 VTSLPPNDGIKTENETSNYTCTADGKPAPDILWF 651 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 29.1 bits (62), Expect = 3.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 579 ELTCEAAGSPAPSVHWFK 632 +L C A GSP P ++W K Sbjct: 810 DLRCRATGSPKPKIYWLK 827 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 29.1 bits (62), Expect = 3.1 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 11/71 (15%) Frame = +3 Query: 453 LLSDIDNSIENGVQAKSDGSHKYLS------ITQGPLPSYAHTP-----GTTIELTCEAA 599 +L+DI +S E Q + G+ K L +T P+ + P G + L+C A Sbjct: 29 ILNDIRDSDEGEYQLRLRGTAKPLDSVIALFVTDPPVITLQPEPTVVREGNPLILSCAAD 88 Query: 600 GSPAPSVHWFK 632 G P PS W K Sbjct: 89 GRPIPSYEWLK 99 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L+C A G+P+P W+K Sbjct: 165 GASETLSCPAVGNPSPIYQWYK 186 >SB_24929| Best HMM Match : ig (HMM E-Value=8.2e-06) Length = 186 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHW 626 T +TC A+G PAP+V W Sbjct: 114 TDFSITCSASGRPAPNVTW 132 >SB_13005| Best HMM Match : PSI (HMM E-Value=2.9e-11) Length = 829 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +3 Query: 435 LNKHIKLLSDIDNSIENG--VQAKSDGSHK-YLSITQGPLPSY 554 L+KH +LLSD+ ++++G V D H+ Y T+GP Y Sbjct: 645 LDKHQELLSDLQQAVDDGKLVSFTVDSKHRLYNYNTKGPTGGY 687 >SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1226 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ L C A G P P + W K Sbjct: 389 GATLTLQCSATGVPPPRITWLK 410 >SB_45516| Best HMM Match : I-set (HMM E-Value=1.1e-26) Length = 939 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I P + + G +L C+A G P P V W+K Sbjct: 148 IKSSPPATVQYKEGEVKKLVCKATGKPNPWVIWYK 182 >SB_38860| Best HMM Match : GRP (HMM E-Value=0.47) Length = 212 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 284 YRKYFT*ICKKITLPNNETNLSLMKYCSY 198 +RKY + K++ LP+ T + KYC Y Sbjct: 181 FRKYCEGLPKELRLPSESTATTFRKYCEY 209 >SB_37927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWF 629 G + +TC+ GSPAP V WF Sbjct: 528 GESHTVTCQFQGSPAPLVTWF 548 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +3 Query: 474 SIENGVQAKSDGSHKYL----SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 ++ NG+ +H ++ +IT P +A G+T L C G P+P + W++ Sbjct: 703 NVTNGLATHVGVAHLFVQVPAAITSFTAPRFAQLNGSTT-LICLTRGIPSPRITWYR 758 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 +T C+A+G P P+V W++ Sbjct: 649 STASFECQASGDPTPTVTWYR 669 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G +++L C A G P P+V W K Sbjct: 164 GNSLKLDCSADGKPRPTVVWLK 185 >SB_46724| Best HMM Match : I-set (HMM E-Value=6.1e-11) Length = 133 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHW 626 ++LTCE+ G PAP+V W Sbjct: 70 LKLTCESDGYPAPTVTW 86 >SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) Length = 561 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 546 PSYAH-TPGTTIELTCEAAGSPAPSVHWFK 632 P Y + T G + +TC++ P P+V W+K Sbjct: 193 PLYLNVTEGEPVNITCQSNDLPRPTVTWYK 222 >SB_31893| Best HMM Match : I-set (HMM E-Value=2e-22) Length = 767 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +IT P P G+ T +A+G P P +W K Sbjct: 326 NITVKPPPKITLKAGSPFTFTAKASGFPVPDTYWTK 361 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T I L C A G+P+P++ W+K Sbjct: 518 TPIILNCTAKGTPSPTLTWYK 538 >SB_57324| Best HMM Match : ig (HMM E-Value=1e-26) Length = 947 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G+ ++L C A GSP P + W Sbjct: 532 GSQLKLRCHANGSPQPKIQW 551 >SB_30961| Best HMM Match : I-set (HMM E-Value=0) Length = 1018 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHW 626 +I LTC+ G P PSV W Sbjct: 753 SINLTCDVEGGPLPSVTW 770 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 SI LP T L CEA GSP P++ W+ Sbjct: 709 SIFDRTLPDTLSKWKTFAILNCEAYGSPQPTMFWY 743 >SB_54071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G ++L C A G P P++ W K Sbjct: 195 GDNLQLNCSATGCPIPTLTWLK 216 >SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1604 Score = 28.3 bits (60), Expect = 5.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 +++ L C G+P P+V W+K Sbjct: 1027 SSVALQCHVTGNPPPTVRWYK 1047 >SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1189 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+ + C A G+P P+V+W K Sbjct: 398 GSVVTFNCTADGNPKPNVYWSK 419 >SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 2675 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 LTC A G+P PSV W K Sbjct: 706 LTCRAEGNPEPSVGWKK 722 >SB_9034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1756 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G ++L C A G P P++ W K Sbjct: 784 GDNLQLNCSATGCPIPTLTWLK 805 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/53 (22%), Positives = 21/53 (39%) Frame = +3 Query: 468 DNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 DN + G + + + S++ G L C A G P P+++W Sbjct: 838 DNGVSGGHPRQQIRVVVRIPVITSEQSSHSFNEGDQASLYCNATGYPTPNINW 890 >SB_1442| Best HMM Match : SRCR (HMM E-Value=0) Length = 2103 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S P +I+L C A G P P++ W++ Sbjct: 1425 SMVEDPVRSIQLFCNATGFPIPTITWWR 1452 >SB_55607| Best HMM Match : ig (HMM E-Value=4.6e-17) Length = 274 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G+ + + C A GSP P+V W Sbjct: 20 GSDVAVACVATGSPKPTVEW 39 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L C+A+GSP P W+K Sbjct: 511 GESAVLECKASGSPMPRFTWYK 532 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 459 SDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPA 611 SD++N+ E GV KS + PL HTP + AA SP+ Sbjct: 1035 SDVNNNSEGGVSGKSPVKPDVTATRISPLLPPTHTPNSGPLEENPAASSPS 1085 >SB_10883| Best HMM Match : ig (HMM E-Value=7.00649e-43) Length = 1280 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHW 626 T EL C A G+P P+V W Sbjct: 994 TAELMCSATGNPKPNVTW 1011 >SB_51604| Best HMM Match : I-set (HMM E-Value=2.3e-21) Length = 152 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHW 626 +TI + C A G PAP V W Sbjct: 78 STIRIVCNATGLPAPRVTW 96 >SB_44087| Best HMM Match : I-set (HMM E-Value=1.5e-05) Length = 267 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+++ L C+ G P P++ W K Sbjct: 197 GSSVSLECDVKGKPPPNITWSK 218 >SB_43971| Best HMM Match : I-set (HMM E-Value=1.7e-09) Length = 240 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHW 626 + +TC A+G PAP+V W Sbjct: 170 VTVTCSASGRPAPNVTW 186 >SB_43084| Best HMM Match : ig (HMM E-Value=9.7e-23) Length = 960 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHW 626 T EL C A G+P P+V W Sbjct: 136 TAELMCSATGNPKPNVTW 153 >SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1554 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T +C+A+G+P P+V W + Sbjct: 628 TNFNQSCQASGNPVPTVQWMR 648 Score = 27.5 bits (58), Expect = 9.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +E+ C+ +G P P+V W+K Sbjct: 516 VEVNCKVSGYPKPTVIWYK 534 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G ++EL C A G+P P V W Sbjct: 227 GESLELRCFATGNPTPEVIW 246 >SB_29125| Best HMM Match : I-set (HMM E-Value=1.8e-09) Length = 108 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHW 626 T++ + C A G+P PS+ W Sbjct: 36 TSVSIHCNATGNPVPSITW 54 >SB_16652| Best HMM Match : I-set (HMM E-Value=1.2e-37) Length = 552 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +3 Query: 450 KLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 K L + NS+ V++ +I P + A+ G + L C A+ PAP ++W Sbjct: 334 KYLCNASNSMGWAVESAHVDVQYPPTIVTTPKNTTAYLGGN-VTLYCNASSHPAPQIYWA 392 Query: 630 K 632 K Sbjct: 393 K 393 >SB_11355| Best HMM Match : I-set (HMM E-Value=1.5e-05) Length = 288 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+++ L C+ G P P++ W K Sbjct: 153 GSSVSLECDVKGKPPPNITWSK 174 >SB_53160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 27.5 bits (58), Expect = 9.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHW 626 + +TC A+G PAP++ W Sbjct: 187 VTVTCSASGRPAPNITW 203 >SB_48846| Best HMM Match : Pkinase_Tyr (HMM E-Value=8.1e-16) Length = 523 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + LTC GSP P V W K Sbjct: 10 GLDVSLTCLFTGSPLPRVTWSK 31 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 27.5 bits (58), Expect = 9.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + L C+ G P+P + W+K Sbjct: 8 GKVLSLQCKVRGLPSPQITWYK 29 >SB_30807| Best HMM Match : I-set (HMM E-Value=7.8e-08) Length = 148 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC A+G PAP+V W Sbjct: 30 ITCSASGRPAPNVTW 44 >SB_28589| Best HMM Match : ig (HMM E-Value=1.1e-05) Length = 91 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC A+G PAP+V W Sbjct: 23 ITCSASGRPAPNVTW 37 >SB_20377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 445 TLSCFRTSITVLRMVCKQNLMDLINIYRSRKAPYR--RTHILPEP 573 T SC +++ V + V +L DL +I ++ PYR H++ +P Sbjct: 41 TCSCRHSNLVVAQSVFVNSLSDLTSISQNSVKPYRLKLVHVVRDP 85 >SB_16822| Best HMM Match : I-set (HMM E-Value=1.3e-07) Length = 259 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC A+G PAP+V W Sbjct: 145 ITCSASGRPAPNVTW 159 >SB_8401| Best HMM Match : ig (HMM E-Value=8.1e-22) Length = 965 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 480 ENGVQAKSDGSHKYLSITQGPLPSYAH---TPGTTIELTCEAAGSPAPSVHW 626 +NG + + S L + P ++A+ T L C A G+P P+V W Sbjct: 694 DNGGETTFEASKFTLDVLVPPSVTHANITVNKTNTAVLMCSATGNPTPNVTW 745 >SB_58211| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 1316 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +T GP S T L C A+G+P P V W Sbjct: 1229 VTTGPPKSIRVNVSTQAWLPCVASGNPHPVVTW 1261 >SB_41624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 ++ ELTC SP P+V W K Sbjct: 608 SSFELTCVVTASPGPTVTWTK 628 >SB_18843| Best HMM Match : I-set (HMM E-Value=1e-07) Length = 339 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 582 LTCEAAGSPAPSVHW 626 +TC A+G PAP+V W Sbjct: 271 ITCSASGRPAPNVTW 285 >SB_18521| Best HMM Match : ig (HMM E-Value=7.5e-11) Length = 1033 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 564 PGTTIELTCEAAGSPAPSVHWF 629 P +EL C G P P+V WF Sbjct: 285 PEENVELHCFPTGRPTPNVTWF 306 >SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39) Length = 1060 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -1 Query: 278 KYFT*ICKKITLPNNETNLSLMKYCSYYSFCYKFKWRTATR 156 ++FT +K+ N++ + CSY YK+K+ T TR Sbjct: 528 RFFTKAIEKV---NSKETSHIASVCSYRYLSYKYKYNTFTR 565 >SB_5575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 8/46 (17%) Frame = +3 Query: 519 YLSITQGPLP---SYAHTPGTTIE-----LTCEAAGSPAPSVHWFK 632 +L + QG P S+ TP T +E + C + G PAP ++W K Sbjct: 131 FLVVNQGVAPLLMSFPTTPLTIVENSTAVVPCISTGFPAPVINWTK 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,239,601 Number of Sequences: 59808 Number of extensions: 394049 Number of successful extensions: 1463 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -