BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a18 (632 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89336-3|AAB47491.1| 404|Homo sapiens receptor for advanced gly... 38 0.039 M91211-1|AAA03574.1| 404|Homo sapiens receptor for advanced gly... 38 0.039 D28769-2|BAA05958.1| 404|Homo sapiens receptor of advanced glyc... 38 0.039 DQ104254-1|AAZ32415.1| 303|Homo sapiens receptor for advanced g... 38 0.039 DQ104253-1|AAZ32414.1| 293|Homo sapiens receptor for advanced g... 38 0.039 DQ104252-1|AAZ32413.1| 390|Homo sapiens receptor for advanced g... 38 0.039 DQ104251-1|AAZ32412.1| 323|Homo sapiens receptor for advanced g... 38 0.039 BX284686-17|CAM26225.1| 347|Homo sapiens advanced glycosylation... 38 0.039 BX284686-16|CAM26224.1| 404|Homo sapiens advanced glycosylation... 38 0.039 BX284686-15|CAM26223.1| 342|Homo sapiens advanced glycosylation... 38 0.039 BC020669-1|AAH20669.1| 404|Homo sapiens advanced glycosylation ... 38 0.039 AY755628-1|AAX07281.1| 347|Homo sapiens receptor for advanced g... 38 0.039 AY755624-1|AAX07277.1| 390|Homo sapiens receptor for advanced g... 38 0.039 AY755623-1|AAX07276.1| 355|Homo sapiens receptor for advanced g... 38 0.039 AY755622-1|AAX07275.1| 363|Homo sapiens receptor for advanced g... 38 0.039 AY755621-1|AAX07274.1| 420|Homo sapiens receptor for advanced g... 38 0.039 AY755620-1|AAX07273.1| 347|Homo sapiens receptor for advanced g... 38 0.039 AY755619-1|AAX07272.1| 404|Homo sapiens receptor for advanced g... 38 0.039 AL845464-17|CAM25716.1| 347|Homo sapiens advanced glycosylation... 38 0.039 AL845464-16|CAI41810.1| 404|Homo sapiens advanced glycosylation... 38 0.039 AL845464-15|CAI41809.1| 342|Homo sapiens advanced glycosylation... 38 0.039 AL662884-22|CAM25647.1| 347|Homo sapiens advanced glycosylation... 38 0.039 AL662884-21|CAI18354.1| 404|Homo sapiens advanced glycosylation... 38 0.039 AL662884-20|CAI18355.1| 342|Homo sapiens advanced glycosylation... 38 0.039 AL662830-4|CAM24893.1| 347|Homo sapiens advanced glycosylation ... 38 0.039 AL662830-3|CAI17536.1| 404|Homo sapiens advanced glycosylation ... 38 0.039 AL662830-2|CAI17535.1| 342|Homo sapiens advanced glycosylation ... 38 0.039 AJ133822-1|CAB43108.1| 342|Homo sapiens receptor for Advanced G... 38 0.039 AF536237-1|AAQ10686.1| 147|Homo sapiens advanced glycosylation ... 38 0.039 AB061669-1|BAC65466.1| 303|Homo sapiens N-terminal truncated fo... 38 0.039 AB061668-1|BAC65465.1| 347|Homo sapiens soluble form of recepto... 38 0.039 AB036432-1|BAA89369.1| 404|Homo sapiens advanced glycation endp... 38 0.039 AJ277892-2|CAD12456.1|30017|Homo sapiens Titin protein. 37 0.068 M97675-1|AAA60275.1| 937|Homo sapiens transmembrane receptor pr... 36 0.090 BC128386-1|AAI28387.1| 940|Homo sapiens ROR1 protein protein. 36 0.090 BC080541-1|AAH80541.1| 393|Homo sapiens ROR1 protein protein. 36 0.090 BC030143-1|AAH30143.1| 813|Homo sapiens mucosa associated lymph... 36 0.090 AL445205-2|CAH71706.1| 937|Homo sapiens receptor tyrosine kinas... 36 0.090 AL445205-1|CAH71705.1| 393|Homo sapiens receptor tyrosine kinas... 36 0.090 AL161742-2|CAI21932.1| 937|Homo sapiens receptor tyrosine kinas... 36 0.090 AL161742-1|CAI21931.1| 393|Homo sapiens receptor tyrosine kinas... 36 0.090 AL137859-2|CAI21732.1| 937|Homo sapiens receptor tyrosine kinas... 36 0.090 AL137859-1|CAC17591.2| 393|Homo sapiens receptor tyrosine kinas... 36 0.090 AF316597-1|AAG38589.1| 824|Homo sapiens paracaspase protein. 36 0.090 AF130356-1|AAD38507.2| 824|Homo sapiens MALT lymphoma associate... 36 0.090 AF123094-1|AAD46161.1| 1140|Homo sapiens API2-MLT fusion protein... 36 0.090 AB026118-1|BAA83099.1| 813|Homo sapiens MALT1 protein. 36 0.090 AL834139-1|CAD38854.1| 1340|Homo sapiens hypothetical protein pr... 36 0.16 M85289-1|AAA52700.1| 4391|Homo sapiens heparan sulfate proteogly... 35 0.21 BC066363-1|AAH66363.1| 1805|Homo sapiens SDK2 protein protein. 35 0.21 AL590556-2|CAH71870.1| 4391|Homo sapiens heparan sulfate proteog... 35 0.21 AL590103-2|CAI12125.1| 4391|Homo sapiens heparan sulfate proteog... 35 0.21 AL445795-1|CAC18534.1| 4370|Homo sapiens heparan sulfate proteog... 35 0.21 AB209851-1|BAD93088.1| 2331|Homo sapiens Basement membrane-speci... 35 0.21 AB040947-1|BAA96038.1| 1598|Homo sapiens KIAA1514 protein protein. 35 0.21 X90569-1|CAA62189.1| 7962|Homo sapiens elastic titin protein. 35 0.28 X61656-1|CAA43837.1| 1354|Homo sapiens membrane protein protein. 35 0.28 L04947-1|AAA59459.1| 1354|Homo sapiens receptor tyrosine kinase ... 35 0.28 BX928748-1|CAH74051.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 BC131822-1|AAI31823.1| 1356|Homo sapiens kinase insert domain re... 35 0.28 AY942196-1|AAX20110.1| 385|Homo sapiens basigin (OK blood group... 35 0.28 AY358113-1|AAQ88480.1| 385|Homo sapiens EMMPRIN protein. 35 0.28 AL391824-1|CAI17865.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AL135797-1|CAI17871.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AL135796-1|CAI17854.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AL133553-2|CAI17858.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AL133515-1|CAI17853.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AL121996-1|CAI17844.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AL118512-1|CAI17864.1| 5635|Homo sapiens protein ( Human DNA seq... 35 0.28 AF548371-1|AAN40694.1| 385|Homo sapiens basigin long isoform pr... 35 0.28 AF063658-1|AAC16450.1| 1356|Homo sapiens vascular endothelial gr... 35 0.28 AF035121-1|AAB88005.1| 1356|Homo sapiens KDR/flk-1 protein protein. 35 0.28 AB209901-1|BAD93138.1| 1451|Homo sapiens kinase insert domain re... 35 0.28 Y13901-1|CAA74200.1| 802|Homo sapiens fibroblast growth factor ... 34 0.36 U27266-1|AAB86737.1| 477|Homo sapiens myosin binding protein H ... 34 0.36 EF571596-1|ABQ01235.1| 802|Homo sapiens fibroblast growth facto... 34 0.36 BC071561-1|AAH71561.1| 1070|Homo sapiens LRIG1 protein protein. 34 0.36 BC067101-1|AAH67101.1| 1212|Homo sapiens MYOM3 protein protein. 34 0.36 BC044226-1|AAH44226.1| 477|Homo sapiens myosin binding protein ... 34 0.36 BC014276-1|AAH14276.2| 417|Homo sapiens LRIG1 protein protein. 34 0.36 AY730707-1|AAU44786.1| 1093|Homo sapiens leucine-rich repeat pro... 34 0.36 AL591178-3|CAH72090.1| 1437|Homo sapiens myomesin family, member... 34 0.36 AL117666-1|CAB56036.1| 483|Homo sapiens hypothetical protein pr... 34 0.36 AJ410920-1|CAC39388.1| 96|Homo sapiens immunoglobulin lambda c... 34 0.36 AF487555-1|AAM13666.1| 802|Homo sapiens fibroblast growth facto... 34 0.36 AF381545-1|AAK62357.1| 1093|Homo sapiens membrane glycoprotein L... 34 0.36 AF202063-1|AAF27432.1| 762|Homo sapiens fibroblast growth facto... 34 0.36 AB050468-1|BAB40659.1| 1094|Homo sapiens membrane glycoprotein L... 34 0.36 X76132-1|CAA53735.1| 1447|Homo sapiens tumour suppressor protein. 33 0.64 M32292-1|AAA35751.1| 750|Homo sapiens protein ( Human colorecta... 33 0.64 BC117674-1|AAI17675.2| 1240|Homo sapiens NFASC protein protein. 33 0.64 BC036524-1|AAH36524.1| 772|Homo sapiens DCC protein protein. 33 0.64 BC013867-1|AAH13867.2| 510|Homo sapiens PALLD protein protein. 33 0.64 BC010423-1|AAH10423.1| 510|Homo sapiens PVRL4 protein protein. 33 0.64 AY211921-1|AAO65174.1| 294|Homo sapiens sarcoma antigen NY-SAR-... 33 0.64 AL834247-1|CAD38923.2| 1391|Homo sapiens hypothetical protein pr... 33 0.64 AL832379-1|CAD91155.1| 1045|Homo sapiens hypothetical protein pr... 33 0.64 AL832002-1|CAD89906.1| 1320|Homo sapiens hypothetical protein pr... 33 0.64 AL591806-13|CAI15376.1| 510|Homo sapiens poliovirus receptor-re... 33 0.64 AL512429-2|CAH73748.1| 1320|Homo sapiens sarcomeric protein myop... 33 0.64 AL512429-1|CAH73747.1| 1045|Homo sapiens sarcomeric protein myop... 33 0.64 AL391822-8|CAI14664.1| 1040|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-7|CAI14662.1| 1165|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-6|CAI14658.1| 1174|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-5|CAI14660.1| 1347|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-4|CAI14661.1| 1157|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-3|CAI14659.1| 1240|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-2|CAI14657.1| 619|Homo sapiens neurofascin homolog (ch... 33 0.64 AL391822-1|CAI14656.1| 302|Homo sapiens neurofascin homolog (ch... 33 0.64 AK027753-1|BAB55344.1| 510|Homo sapiens protein ( Homo sapiens ... 33 0.64 AF464873-1|AAL69964.1| 1106|Homo sapiens myoneurin protein. 33 0.64 AF426163-1|AAL23958.1| 510|Homo sapiens nectin 4 protein. 33 0.64 AF328296-1|AAK50625.1| 1320|Homo sapiens myopalladin protein. 33 0.64 AF160477-1|AAF82399.1| 510|Homo sapiens Ig superfamily receptor... 33 0.64 AF156100-1|AAK68690.1| 5636|Homo sapiens hemicentin protein. 33 0.64 AF151909-1|AAD34146.1| 404|Homo sapiens CGI-151 protein protein. 33 0.64 AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. 33 0.64 AB018299-1|BAA34476.3| 1222|Homo sapiens KIAA0756 protein protein. 33 0.64 X57205-1|CAA40490.1| 802|Homo sapiens fibroblast growth factor ... 33 0.84 L03840-1|AAB59389.1| 802|Homo sapiens fibroblast growth factor ... 33 0.84 BC011847-1|AAH11847.1| 802|Homo sapiens fibroblast growth facto... 33 0.84 AY928131-1|AAY16611.1| 127|Homo sapiens immunoglobulin lambda l... 33 0.84 AB209631-1|BAD92868.1| 1034|Homo sapiens Fibroblast growth facto... 33 0.84 BC117370-1|AAI17371.1| 1065|Homo sapiens leucine-rich repeats an... 33 1.1 BC117368-1|AAI17369.1| 1065|Homo sapiens leucine-rich repeats an... 33 1.1 BC114435-1|AAI14436.1| 1264|Homo sapiens Cdon homolog (mouse) pr... 33 1.1 BC098583-1|AAH98583.1| 1287|Homo sapiens Cdon homolog (mouse) pr... 33 1.1 AL357055-1|CAH73254.1| 1065|Homo sapiens leucine-rich repeats an... 33 1.1 AF060139-1|AAC15212.1| 108|Homo sapiens immunoglobulin lambda l... 33 1.1 AF004841-1|AAC34901.2| 1264|Homo sapiens CDO protein. 33 1.1 AB018349-1|BAA34526.2| 1073|Homo sapiens KIAA0806 protein protein. 33 1.1 Y10129-1|CAA71216.1| 1274|Homo sapiens myosin binding protein C ... 32 1.5 X90568-1|CAA62188.1|26926|Homo sapiens titin protein. 32 1.5 X84075-1|CAA58882.1| 1274|Homo sapiens cardiac myosin-binding pr... 32 1.5 U91629-1|AAC04620.1| 1274|Homo sapiens cardiac myosin binding pr... 32 1.5 M63702-1|AAA52179.1| 94|Homo sapiens DCC protein. 32 1.5 M32286-1|AAA52174.1| 53|Homo sapiens colorectal tumor suppress... 32 1.5 EF560722-1|ABQ59032.1| 1274|Homo sapiens MYBPC3 protein protein. 32 1.5 BX538319-1|CAD98093.1| 1290|Homo sapiens hypothetical protein pr... 32 1.5 BC151211-1|AAI51212.1| 1274|Homo sapiens myosin binding protein ... 32 1.5 BC142685-1|AAI42686.1| 1274|Homo sapiens myosin binding protein ... 32 1.5 BC115022-1|AAI15023.1| 1551|Homo sapiens ROBO1 protein protein. 32 1.5 BC115020-1|AAI15021.1| 1606|Homo sapiens ROBO1 protein protein. 32 1.5 BC112336-1|AAI12337.1| 1607|Homo sapiens ROBO1 protein protein. 32 1.5 BC107797-1|AAI07798.1| 179|Homo sapiens TTN protein protein. 32 1.5 BC067107-1|AAH67107.1| 814|Homo sapiens putative neuronal cell ... 32 1.5 BC054883-1|AAH54883.1| 234|Homo sapiens Unknown (protein for MG... 32 1.5 BC042054-1|AAH42054.1| 814|Homo sapiens putative neuronal cell ... 32 1.5 BC036502-1|AAH36502.1| 847|Homo sapiens follistatin-like 5 prot... 32 1.5 AY518390-1|AAR89909.1| 1273|Homo sapiens myosin binding protein ... 32 1.5 AL713647-1|CAD28458.1| 1232|Homo sapiens hypothetical protein pr... 32 1.5 AL137695-1|CAB70877.1| 773|Homo sapiens hypothetical protein pr... 32 1.5 AK093583-1|BAC04201.1| 329|Homo sapiens protein ( Homo sapiens ... 32 1.5 AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein. 32 1.5 AF491813-1|AAM09558.1| 2113|Homo sapiens Down syndrome cell adhe... 32 1.5 AF334384-1|AAL57166.1| 2053|Homo sapiens Down syndrome cell adhe... 32 1.5 AF304304-1|AAN32613.1| 2053|Homo sapiens Down syndrome cell adhe... 32 1.5 AF040990-1|AAC39575.1| 1651|Homo sapiens roundabout 1 protein. 32 1.5 AC079227-1|AAY40948.1| 274|Homo sapiens unknown protein. 32 1.5 AB033089-1|BAA86577.1| 850|Homo sapiens KIAA1263 protein protein. 32 1.5 AB032958-1|BAA86446.2| 2092|Homo sapiens KIAA1132 protein protein. 32 1.5 X69089-1|CAA48832.1| 1465|Homo sapiens 165kD protein protein. 32 1.9 U41725-1|AAD09360.1| 1502|Homo sapiens PTPsigma-(brain) protein. 32 1.9 U40317-1|AAC50567.1| 1911|Homo sapiens PTPsigma protein. 32 1.9 U35234-1|AAC50299.1| 1948|Homo sapiens protein tyrosine phosphat... 32 1.9 L38929-1|AAC41749.1| 1912|Homo sapiens protein tyrosine phosphat... 32 1.9 BC130619-1|AAI30620.1| 1100|Homo sapiens CNTN5 protein protein. 32 1.9 BC106716-1|AAI06717.1| 1496|Homo sapiens PTPRD protein protein. 32 1.9 BC106715-1|AAI06716.1| 1505|Homo sapiens PTPRD protein protein. 32 1.9 BC106714-1|AAI06715.1| 1506|Homo sapiens PTPRD protein protein. 32 1.9 BC106713-1|AAI06714.1| 1505|Homo sapiens PTPRD protein protein. 32 1.9 BC104812-1|AAI04813.1| 1501|Homo sapiens protein tyrosine phosph... 32 1.9 BC052969-1|AAH52969.1| 1465|Homo sapiens myomesin (M-protein) 2,... 32 1.9 BC039255-1|AAH39255.1| 617|Homo sapiens CNTN5 protein protein. 32 1.9 AY369208-1|AAQ73312.1| 956|Homo sapiens MAM domain-containing g... 32 1.9 AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608 pr... 32 1.9 AL590397-1|CAH73128.2| 1912|Homo sapiens protein tyrosine phosph... 32 1.9 AL583805-2|CAH70443.2| 1912|Homo sapiens protein tyrosine phosph... 32 1.9 AL445926-1|CAH73847.2| 1912|Homo sapiens protein tyrosine phosph... 32 1.9 AL356584-1|CAI16146.2| 1912|Homo sapiens protein tyrosine phosph... 32 1.9 AL137125-1|CAH70912.2| 1912|Homo sapiens protein tyrosine phosph... 32 1.9 AL049946-1|CAB43220.1| 584|Homo sapiens hypothetical protein pr... 32 1.9 AK128160-1|BAC87305.1| 632|Homo sapiens protein ( Homo sapiens ... 32 1.9 AJ578212-1|CAE18213.1| 107|Homo sapiens immunoglobulin lambda-1... 32 1.9 AF245505-1|AAF86402.1| 2828|Homo sapiens adlican protein. 32 1.9 AF063726-1|AAC16807.1| 108|Homo sapiens immunoglobulin lambda l... 32 1.9 AC005338-1|AAC27825.1| 475|Homo sapiens PTPsigma, partial CDS p... 32 1.9 AB211400-1|BAE79816.1| 1912|Homo sapiens protein tyrosine phosph... 32 1.9 AB209333-1|BAD92570.1| 1560|Homo sapiens protein tyrosine phosph... 32 1.9 AB208869-1|BAD92106.1| 1478|Homo sapiens protein tyrosine phosph... 32 1.9 AB013803-1|BAA36580.2| 1026|Homo sapiens hNB-2s protein. 32 1.9 AB013802-1|BAA36579.2| 1100|Homo sapiens hNB-2 protein. 32 1.9 Z29373-1|CAA82564.1| 1257|Homo sapiens neural cell adhesion mole... 31 2.6 Y00815-1|CAA68754.1| 1897|Homo sapiens put. LAR preprotein (AA -... 31 2.6 X62515-1|CAA44373.1| 4393|Homo sapiens Human basement membrane h... 31 2.6 X59847-1|CAA42508.1| 1257|Homo sapiens Neural cell adhesion mole... 31 2.6 X58776-1|CAB37831.1| 824|Homo sapiens cell adhesion molecule L1... 31 2.6 X16455-1|CAA34474.1| 697|Homo sapiens pCEA80-11 protein (647 AA... 31 2.6 M77640-1|AAC14352.1| 1257|Homo sapiens L1 cell adhesion molecule... 31 2.6 M74387-1|AAA59476.1| 1253|Homo sapiens cell adhesion molecule L1... 31 2.6 M59262-1|AAA62835.1| 702|Homo sapiens carcinoembryonic antigen ... 31 2.6 M29540-1|AAA51967.1| 702|Homo sapiens CEA protein. 31 2.6 M17303-1|AAB59513.1| 702|Homo sapiens CEA protein. 31 2.6 M17191-1|AAA51968.1| 287|Homo sapiens CEA protein. 31 2.6 M16234-1|AAA51972.1| 372|Homo sapiens CEA protein. 31 2.6 M15042-1|AAA51963.1| 698|Homo sapiens CEA protein. 31 2.6 EF506611-1|ABP88252.1| 1248|Homo sapiens non-neural L1CAM protein. 31 2.6 D86983-1|BAA13219.1| 1496|Homo sapiens KIAA0230 protein. 31 2.6 DQ173642-2|ABC25979.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173641-2|ABC25974.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173640-2|ABC25969.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173639-2|ABC25964.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173638-2|ABC25959.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173637-2|ABC25954.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173636-2|ABC25949.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173635-2|ABC25944.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173634-2|ABC25939.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173633-2|ABC25934.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173632-2|ABC25929.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173631-2|ABC25924.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173630-2|ABC25919.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173629-2|ABC25914.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173628-2|ABC25909.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173627-2|ABC25904.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173626-2|ABC25899.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173625-2|ABC25894.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173624-2|ABC25889.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173623-2|ABC25884.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173622-2|ABC25879.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173621-2|ABC25874.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173620-2|ABC25869.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173619-2|ABC25864.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173618-2|ABC25859.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173617-2|ABC25854.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173616-2|ABC25849.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173615-2|ABC25844.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173614-2|ABC25839.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173613-2|ABC25834.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173612-2|ABC25829.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173611-2|ABC25824.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173610-2|ABC25819.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173609-2|ABC25814.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173608-2|ABC25809.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173607-2|ABC25804.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173606-2|ABC25799.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173605-2|ABC25794.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173604-2|ABC25789.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173603-2|ABC25784.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173602-2|ABC25779.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173601-2|ABC25774.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173600-2|ABC25769.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173599-2|ABC25764.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173598-2|ABC25759.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173597-2|ABC25755.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173596-2|ABC25750.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173595-2|ABC25745.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173594-2|ABC25740.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173593-2|ABC25735.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173592-2|ABC25730.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 DQ173589-1|ABB58724.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 BX538014-1|CAD97961.1| 355|Homo sapiens hypothetical protein pr... 31 2.6 BC126229-1|AAI26230.1| 1257|Homo sapiens L1 cell adhesion molecu... 31 2.6 BC098579-1|AAH98579.1| 722|Homo sapiens PXDN protein protein. 31 2.6 BC048768-1|AAH48768.1| 1898|Homo sapiens protein tyrosine phosph... 31 2.6 BC036771-1|AAH36771.1| 226|Homo sapiens NEGR1 protein protein. 31 2.6 BC034671-1|AAH34671.1| 702|Homo sapiens carcinoembryonic antige... 31 2.6 AY358132-1|AAQ88499.1| 352|Homo sapiens DMML2433 protein. 31 2.6 AY167726-1|AAO17629.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167725-1|AAO17628.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167724-1|AAO17627.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167723-1|AAO17626.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167722-1|AAO17625.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167721-1|AAO17624.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167720-1|AAO17623.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167719-1|AAO17622.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167718-1|AAO17621.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167717-1|AAO17620.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167716-1|AAO17619.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167715-1|AAO17618.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167714-1|AAO17617.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167713-1|AAO17616.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167712-1|AAO17615.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167711-1|AAO17614.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167710-1|AAO17613.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167709-1|AAO17612.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167708-1|AAO17611.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167707-1|AAO17610.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167706-1|AAO17609.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167705-1|AAO17608.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167704-1|AAO17607.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167703-1|AAO17606.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167702-1|AAO17605.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167701-1|AAO17604.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167700-1|AAO17603.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167699-1|AAO17602.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167698-1|AAO17601.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167697-1|AAO17600.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167696-1|AAO17599.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167695-1|AAO17598.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167694-1|AAO17597.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167693-1|AAO17596.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167692-1|AAO17595.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167691-1|AAO17594.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167690-1|AAO17593.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167689-1|AAO17592.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167688-1|AAO17591.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167687-1|AAO17590.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167686-1|AAO17589.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167685-1|AAO17588.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167684-1|AAO17587.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167683-1|AAO17586.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167682-1|AAO17585.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167681-1|AAO17584.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AY167680-1|AAO17583.1| 534|Homo sapiens L1 cell adhesion molecu... 31 2.6 AL645724-1|CAI21858.1| 354|Homo sapiens neuronal growth regulat... 31 2.6 AL627317-2|CAH72392.1| 226|Homo sapiens neuronal growth regulat... 31 2.6 AL627317-1|CAH72391.1| 354|Homo sapiens neuronal growth regulat... 31 2.6 AL583862-10|CAI14894.1| 1907|Homo sapiens protein tyrosine phosp... 31 2.6 AL583862-9|CAI14895.1| 1898|Homo sapiens protein tyrosine phosph... 31 2.6 AL359821-2|CAH70914.1| 226|Homo sapiens neuronal growth regulat... 31 2.6 AL359821-1|CAH70913.1| 354|Homo sapiens neuronal growth regulat... 31 2.6 AL356600-2|CAI23493.1| 226|Homo sapiens neuronal growth regulat... 31 2.6 AL356600-1|CAI23492.1| 354|Homo sapiens neuronal growth regulat... 31 2.6 AL354949-2|CAI16870.1| 226|Homo sapiens neuronal growth regulat... 31 2.6 AL354949-1|CAI16869.1| 354|Homo sapiens neuronal growth regulat... 31 2.6 AK223101-1|BAD96821.1| 702|Homo sapiens carcinoembryonic antige... 31 2.6 AF200348-1|AAF06354.1| 1496|Homo sapiens melanoma-associated ant... 31 2.6 AF063745-1|AAC16826.1| 109|Homo sapiens immunoglobulin lambda l... 31 2.6 AB177857-1|BAD66835.1| 1918|Homo sapiens LAR protein. 31 2.6 AB102653-1|BAC81122.1| 1255|Homo sapiens L1 cell adhesion molecu... 31 2.6 BC111013-1|AAI11014.1| 428|Homo sapiens immunoglobulin superfam... 31 3.4 BC070352-1|AAH70352.1| 233|Homo sapiens IGLV3-21 protein protein. 31 3.4 BC022478-1|AAH22478.1| 428|Homo sapiens immunoglobulin superfam... 31 3.4 AY358871-1|AAQ89230.1| 428|Homo sapiens ISLR protein. 31 3.4 AY358330-1|AAQ88696.1| 477|Homo sapiens papilin protein. 31 3.4 AL034397-1|CAI42051.1| 201|Homo sapiens V-set and immunoglobuli... 31 3.4 AK223267-1|BAD96987.1| 428|Homo sapiens immunoglobulin superfam... 31 3.4 AK131073-1|BAC85123.1| 659|Homo sapiens FLJ00259 protein protein. 31 3.4 AK125658-1|BAC86235.1| 309|Homo sapiens protein ( Homo sapiens ... 31 3.4 AK056557-1|BAB71216.1| 1252|Homo sapiens protein ( Homo sapiens ... 31 3.4 AF109907-3|AAC97963.1| 1235|Homo sapiens hypothetical protein pr... 31 3.4 AF063736-1|AAC16817.1| 107|Homo sapiens immunoglobulin lambda l... 31 3.4 AB024537-1|BAA85971.1| 428|Homo sapiens ISLR protein. 31 3.4 AB024536-1|BAA85970.1| 428|Homo sapiens ISLR protein. 31 3.4 AB003184-1|BAA22848.1| 428|Homo sapiens ISLR protein. 31 3.4 X57821-1|CAA40958.1| 232|Homo sapiens immunoglobulin lambda lig... 31 4.5 U55258-1|AAC50765.1| 1299|Homo sapiens hBRAVO/Nr-CAM precursor p... 31 4.5 M94115-1|AAA59027.1| 115|Homo sapiens protein ( Human immunoglo... 31 4.5 M64347-1|AAA58470.1| 731|Homo sapiens fgflr protein. 31 4.5 M58051-1|AAA52450.1| 806|Homo sapiens fibroblast growth factor ... 31 4.5 DQ533874-1|ABF83431.1| 1378|Homo sapiens ROBO2 isoform b protein. 31 4.5 DQ533873-1|ABF83430.1| 1394|Homo sapiens ROBO2 isoform a protein. 31 4.5 BX538010-1|CAD97960.1| 1183|Homo sapiens hypothetical protein pr... 31 4.5 BC146772-1|AAI46773.1| 1378|Homo sapiens roundabout, axon guidan... 31 4.5 BC126171-1|AAI26172.1| 1119|Homo sapiens leucine-rich repeats an... 31 4.5 BC126169-1|AAI26170.1| 1119|Homo sapiens leucine-rich repeats an... 31 4.5 BC115736-1|AAI15737.1| 1192|Homo sapiens NRCAM protein protein. 31 4.5 BC114570-1|AAI14571.1| 1180|Homo sapiens NRCAM protein protein. 31 4.5 BC098401-1|AAH98401.1| 771|Homo sapiens NRCAM protein protein. 31 4.5 BC073787-1|AAH73787.1| 234|Homo sapiens Unknown (protein for MG... 31 4.5 BC028090-1|AAH28090.1| 234|Homo sapiens IGL@ protein protein. 31 4.5 BC024300-1|AAH24300.1| 605|Homo sapiens FSTL4 protein protein. 31 4.5 AY768549-1|AAU89726.1| 806|Homo sapiens fibroblast growth facto... 31 4.5 AY505340-1|AAR98629.1| 1119|Homo sapiens leucine-rich and immuno... 31 4.5 AY358328-1|AAQ88694.1| 1115|Homo sapiens BOC protein. 31 4.5 AY358295-1|AAQ88662.1| 1059|Homo sapiens SAPS287 protein. 31 4.5 AY358288-1|AAQ88655.1| 1119|Homo sapiens SAPS287 protein. 31 4.5 AY190829-1|AAO38735.1| 127|Homo sapiens immunoglobulin lambda l... 31 4.5 AY027658-1|AAK14795.1| 1114|Homo sapiens brother of CDO protein. 31 4.5 AM231061-1|CAJ76912.1| 1960|Homo sapiens obscurin isoform B prot... 31 4.5 AL670729-4|CAH71670.2| 2582|Homo sapiens obscurin, cytoskeletal ... 31 4.5 AL670729-3|CAH71673.1| 6620|Homo sapiens obscurin, cytoskeletal ... 31 4.5 AL359510-13|CAI15072.1| 6620|Homo sapiens obscurin, cytoskeletal... 31 4.5 AL353593-4|CAM27610.1| 2582|Homo sapiens obscurin, cytoskeletal ... 31 4.5 AL353593-3|CAI19285.1| 6620|Homo sapiens obscurin, cytoskeletal ... 31 4.5 AK092307-1|BAC03858.1| 354|Homo sapiens protein ( Homo sapiens ... 31 4.5 AK090455-1|BAC03436.1| 931|Homo sapiens FLJ00376 protein protein. 31 4.5 AK074921-1|BAC11295.1| 697|Homo sapiens protein ( Homo sapiens ... 31 4.5 AK074780-1|BAC11205.1| 570|Homo sapiens protein ( Homo sapiens ... 31 4.5 AK074556-1|BAC11057.1| 789|Homo sapiens protein ( Homo sapiens ... 31 4.5 AJ578244-1|CAE18245.1| 109|Homo sapiens immunoglobulin lambda-1... 31 4.5 AJ314908-1|CAC85755.1| 1020|Homo sapiens obscurin protein. 31 4.5 AJ002535-1|CAC44768.1| 6620|Homo sapiens obscurin protein. 31 4.5 AJ001057-1|CAA04507.1| 1299|Homo sapiens NrCAM protein protein. 31 4.5 AF487554-2|AAM22078.1| 769|Homo sapiens fibroblast growth facto... 31 4.5 AF487554-1|AAM22079.1| 771|Homo sapiens fibroblast growth facto... 31 4.5 AF245114-1|AAF63380.1| 694|Homo sapiens fibroblast growth facto... 31 4.5 AF172277-2|AAF22283.1| 1236|Homo sapiens NgCAM-related related c... 31 4.5 AF172277-1|AAF22282.1| 1308|Homo sapiens NgCAM-related related c... 31 4.5 AF063777-1|AAC16853.1| 108|Homo sapiens immunoglobulin lambda l... 31 4.5 AF063767-1|AAC16844.1| 108|Homo sapiens immunoglobulin lambda l... 31 4.5 AF063747-1|AAC16827.1| 106|Homo sapiens immunoglobulin lambda l... 31 4.5 AF040991-1|AAC39576.1| 285|Homo sapiens roundabout 2 protein. 31 4.5 AC007567-1|AAS07434.1| 383|Homo sapiens unknown protein. 31 4.5 AB209441-1|BAD92678.1| 879|Homo sapiens fibroblast growth facto... 31 4.5 AB046859-1|BAB13465.2| 2584|Homo sapiens KIAA1639 protein protein. 31 4.5 AB046788-1|BAB13394.1| 1380|Homo sapiens KIAA1568 protein protein. 31 4.5 AB028984-1|BAA83013.1| 693|Homo sapiens KIAA1061 protein protein. 31 4.5 AB002341-1|BAA20801.2| 1187|Homo sapiens KIAA0343 protein. 31 4.5 X16841-1|CAA34739.1| 761|Homo sapiens protein ( Human mRNA for ... 30 5.9 U63041-1|AAB04558.1| 848|Homo sapiens neural cell adhesion mole... 30 5.9 U09899-1|AAA56704.1| 95|Homo sapiens immunoglobulin lambda cha... 30 5.9 U09898-1|AAA56703.1| 95|Homo sapiens immunoglobulin lambda cha... 30 5.9 U09893-1|AAA56699.1| 96|Homo sapiens immunoglobulin lambda cha... 30 5.9 S71824-1|AAB31836.1| 848|Homo sapiens N-CAM protein. 30 5.9 M97639-1|AAA60276.1| 943|Homo sapiens transmembrane receptor pr... 30 5.9 M55271-1|AAA36353.1| 48|Homo sapiens neural adhesion molecule ... 30 5.9 DQ098817-1|AAZ13745.1| 108|Homo sapiens immunoglobulin lambda l... 30 5.9 BC130522-1|AAI30523.1| 943|Homo sapiens receptor tyrosine kinas... 30 5.9 BC048416-1|AAH48416.1| 353|Homo sapiens PTPRF protein protein. 30 5.9 BC047244-1|AAH47244.1| 858|Homo sapiens neural cell adhesion mo... 30 5.9 BC029119-1|AAH29119.1| 364|Homo sapiens NCAM1 protein protein. 30 5.9 BC017779-1|AAH17779.1| 298|Homo sapiens junctional adhesion mol... 30 5.9 BC014205-1|AAH14205.2| 601|Homo sapiens NCAM1 protein protein. 30 5.9 BC012102-1|AAH12102.1| 347|Homo sapiens PTPRF protein protein. 30 5.9 AY509035-1|AAS91662.1| 1386|Homo sapiens roundabout-like protein... 30 5.9 AY358361-1|AAQ88727.1| 312|Homo sapiens JAM-IT/VE-JAM protein. 30 5.9 AY077698-1|AAL82538.1| 298|Homo sapiens C21ORF43 protein. 30 5.9 AY016009-1|AAG49022.1| 298|Homo sapiens junctional adhesion mol... 30 5.9 AL928802-2|CAI17303.1| 943|Homo sapiens receptor tyrosine kinas... 30 5.9 AL583862-13|CAI14896.1| 347|Homo sapiens protein tyrosine phosp... 30 5.9 AL583862-12|CAI14897.1| 353|Homo sapiens protein tyrosine phosp... 30 5.9 AL583862-11|CAM12884.1| 262|Homo sapiens protein tyrosine phosp... 30 5.9 AL583841-2|CAI15694.1| 943|Homo sapiens receptor tyrosine kinas... 30 5.9 AL391219-1|CAH70208.1| 943|Homo sapiens receptor tyrosine kinas... 30 5.9 AK056544-1|BAB71212.1| 1034|Homo sapiens protein ( Homo sapiens ... 30 5.9 AJ306906-1|CAC37630.1| 2673|Homo sapiens fibulin-6 protein. 30 5.9 AF294796-1|AAG01184.2| 910|Homo sapiens ROR2 protein protein. 30 5.9 AF279762-1|AAG33132.1| 541|Homo sapiens ROR2 protein. 30 5.9 AF255910-1|AAF81223.1| 298|Homo sapiens vascular endothelial ju... 30 5.9 AF103622-1|AAD16682.1| 108|Homo sapiens immunoglobulin lambda l... 30 5.9 AB209443-1|BAD92680.1| 807|Homo sapiens Neural cell adhesion mo... 30 5.9 AB209154-1|BAD92391.1| 919|Homo sapiens Tyrosine-protein kinase... 30 5.9 AB177856-1|BAD66834.1| 1484|Homo sapiens LAR splice variant 1 pr... 30 5.9 AB052622-1|BAB86306.1| 1250|Homo sapiens hDDM36 protein. 30 5.9 AB046848-1|BAB13454.1| 980|Homo sapiens KIAA1628 protein protein. 30 5.9 X75958-1|CAA53571.1| 477|Homo sapiens protein-tyrosine kinase p... 30 7.8 X53051-1|CAA37218.1| 739|Homo sapiens precursor peptide protein. 30 7.8 X52112-1|CAA36351.1| 130|Homo sapiens immunoglobulin light chai... 30 7.8 U76678-1|AAB18976.1| 107|Homo sapiens IgM light chain variable ... 30 7.8 U75330-1|AAB80803.1| 837|Homo sapiens neural cell adhesion prot... 30 7.8 U48959-1|AAC18423.2| 1914|Homo sapiens myosin light chain kinase... 30 7.8 U12140-1|AAC51371.1| 822|Homo sapiens tyrosine kinase receptor ... 30 7.8 S80751-1|AAB35862.1| 109|Homo sapiens anti-cytomegalovirus glyc... 30 7.8 S76474-1|AAB33110.1| 477|Homo sapiens trkB protein. 30 7.8 S76473-1|AAB33109.1| 822|Homo sapiens trkB protein. 30 7.8 M73255-1|AAA61270.1| 739|Homo sapiens vascular cell adhesion mo... 30 7.8 M60335-1|AAA61269.1| 739|Homo sapiens vascular cell adhesion mo... 30 7.8 M30257-1|AAA51917.1| 647|Homo sapiens VCAM1 protein. 30 7.8 BC089418-1|AAH89418.1| 233|Homo sapiens IGLV3-25 protein protein. 30 7.8 BC085003-1|AAH85003.1| 739|Homo sapiens vascular cell adhesion ... 30 7.8 BC068490-1|AAH68490.2| 739|Homo sapiens vascular cell adhesion ... 30 7.8 BC052946-1|AAH52946.1| 837|Homo sapiens neural cell adhesion mo... 30 7.8 BC031835-1|AAH31835.1| 477|Homo sapiens neurotrophic tyrosine k... 30 7.8 BC025310-1|AAH25310.1| 542|Homo sapiens LRFN1 protein protein. 30 7.8 BC017276-1|AAH17276.3| 739|Homo sapiens vascular cell adhesion ... 30 7.8 BC014678-1|AAH14678.1| 450|Homo sapiens LRFN1 protein protein. 30 7.8 AY867250-1|AAW69121.1| 110|Homo sapiens anti-tetanus toxoid imm... 30 7.8 AY867183-1|AAW69054.1| 107|Homo sapiens anti-tetanus toxoid imm... 30 7.8 AY685384-1|AAT96535.1| 108|Homo sapiens immunoglobulin variable... 30 7.8 AY685377-1|AAT96528.1| 108|Homo sapiens immunoglobulin variable... 30 7.8 AY685372-1|AAT96523.1| 108|Homo sapiens immunoglobulin variable... 30 7.8 AY685369-1|AAT96520.1| 108|Homo sapiens immunoglobulin variable... 30 7.8 AY685366-1|AAT96517.1| 108|Homo sapiens immunoglobulin variable... 30 7.8 AY685363-1|AAT96514.1| 108|Homo sapiens immunoglobulin variable... 30 7.8 AY424270-1|AAR29062.1| 1914|Homo sapiens myosin lignt chain poly... 30 7.8 AY424269-1|AAR29061.1| 1845|Homo sapiens myosin light chain poly... 30 7.8 AY339601-1|AAQ02673.1| 1914|Homo sapiens long myosin light chain... 30 7.8 AY310398-1|AAP75619.1| 2213|Homo sapiens sidekick-like protein 1... 30 7.8 AY190821-1|AAO38727.1| 127|Homo sapiens immunoglobulin lambda l... 30 7.8 AL596132-4|CAH72316.1| 838|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL596132-3|CAH72315.1| 822|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL596132-2|CAH72314.1| 553|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL596132-1|CAH72313.1| 537|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL445532-2|CAH71816.1| 838|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL445532-1|CAH71817.1| 822|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL390777-5|CAH72197.1| 477|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL390777-4|CAH72195.1| 838|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL390777-3|CAH72196.1| 822|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL390777-2|CAH72193.1| 553|Homo sapiens neurotrophic tyrosine k... 30 7.8 AL390777-1|CAH72194.1| 537|Homo sapiens neurotrophic tyrosine k... 30 7.8 AK223266-1|BAD96986.1| 739|Homo sapiens vascular cell adhesion ... 30 7.8 AF536818-1|AAM96190.1| 739|Homo sapiens vascular cell adhesion ... 30 7.8 AF508964-1|AAM77876.1| 477|Homo sapiens protein tyrosine kinase... 30 7.8 AF462646-1|AAM92081.1| 107|Homo sapiens immunoglobulin light ch... 30 7.8 AF410901-1|AAL67967.1| 553|Homo sapiens neurotrophin receptor t... 30 7.8 AF410900-1|AAL67966.1| 537|Homo sapiens neurotrophin receptor t... 30 7.8 AF410899-1|AAL67965.1| 838|Homo sapiens neurotrophin receptor t... 30 7.8 AF400441-1|AAK92490.1| 822|Homo sapiens neurotrophic tyrosine k... 30 7.8 AF069603-1|AAD15923.1| 1793|Homo sapiens myosin light chain kina... 30 7.8 AF069602-1|AAD15922.1| 1862|Homo sapiens myosin light chain kina... 30 7.8 AF069601-1|AAD15921.2| 1845|Homo sapiens myosin light chain kina... 30 7.8 AF063723-1|AAC16804.1| 108|Homo sapiens immunoglobulin lambda l... 30 7.8 AF058077-1|AAC15446.1| 96|Homo sapiens immunoglobulin lambda l... 30 7.8 AF058073-1|AAC15442.1| 108|Homo sapiens immunoglobulin lambda l... 30 7.8 AF058071-1|AAC15440.1| 108|Homo sapiens immunoglobulin lambda l... 30 7.8 AB209118-1|BAD92355.1| 781|Homo sapiens BDNF/NT-3 growth factor... 30 7.8 AB040917-1|BAA96008.1| 700|Homo sapiens KIAA1484 protein protein. 30 7.8 >U89336-3|AAB47491.1| 404|Homo sapiens receptor for advanced glycosylation end products protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >M91211-1|AAA03574.1| 404|Homo sapiens receptor for advanced glycosylation end products protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >D28769-2|BAA05958.1| 404|Homo sapiens receptor of advanced glycosylation end products of proteins protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >DQ104254-1|AAZ32415.1| 303|Homo sapiens receptor for advanced glycation end-products protein. Length = 303 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 147 AVAPGGTVTLTCEVPAQPSPQIHWMK 172 >DQ104253-1|AAZ32414.1| 293|Homo sapiens receptor for advanced glycation end-products protein. Length = 293 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >DQ104252-1|AAZ32413.1| 390|Homo sapiens receptor for advanced glycation end-products protein. Length = 390 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >DQ104251-1|AAZ32412.1| 323|Homo sapiens receptor for advanced glycation end-products protein. Length = 323 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >BX284686-17|CAM26225.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >BX284686-16|CAM26224.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >BX284686-15|CAM26223.1| 342|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 342 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >BC020669-1|AAH20669.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AY755628-1|AAX07281.1| 347|Homo sapiens receptor for advanced glycosylation end-products intron 9 and deletion exon 11 protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AY755624-1|AAX07277.1| 390|Homo sapiens receptor for advanced glycosylation end-products deletion exon 3 variant protein. Length = 390 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >AY755623-1|AAX07276.1| 355|Homo sapiens receptor for advanced glycosylation end-products deletion exon 8 and intron 9 v protein. Length = 355 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AY755622-1|AAX07275.1| 363|Homo sapiens receptor for advanced glycosylation end-products intron 4&9 variant protein. Length = 363 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 264 AVAPGGTVTLTCEVPAQPSPQIHWMK 289 >AY755621-1|AAX07274.1| 420|Homo sapiens receptor for advanced glycosylation end-products intron 4 variant protein. Length = 420 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 264 AVAPGGTVTLTCEVPAQPSPQIHWMK 289 >AY755620-1|AAX07273.1| 347|Homo sapiens receptor for advanced glycosylation end-products intron 9 variant protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AY755619-1|AAX07272.1| 404|Homo sapiens receptor for advanced glycosylation end-products protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL845464-17|CAM25716.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL845464-16|CAI41810.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL845464-15|CAI41809.1| 342|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 342 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >AL662884-22|CAM25647.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL662884-21|CAI18354.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL662884-20|CAI18355.1| 342|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 342 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >AL662830-4|CAM24893.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL662830-3|CAI17536.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AL662830-2|CAI17535.1| 342|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 342 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >AJ133822-1|CAB43108.1| 342|Homo sapiens receptor for Advanced Glycation End Products protein. Length = 342 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 234 AVAPGGTVTLTCEVPAQPSPQIHWMK 259 >AF536237-1|AAQ10686.1| 147|Homo sapiens advanced glycosylation end product-specific receptor variant sRAGE2 protein. Length = 147 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 48 AVAPGGTVTLTCEVPAQPSPQIHWMK 73 >AB061669-1|BAC65466.1| 303|Homo sapiens N-terminal truncated form of receptor for advanced glycation endproducts protein. Length = 303 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 147 AVAPGGTVTLTCEVPAQPSPQIHWMK 172 >AB061668-1|BAC65465.1| 347|Homo sapiens soluble form of receptor for advanced glycation endproducts protein. Length = 347 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AB036432-1|BAA89369.1| 404|Homo sapiens advanced glycation endproducts receptor protein. Length = 404 Score = 37.5 bits (83), Expect = 0.039 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 555 AHTPGTTIELTCEAAGSPAPSVHWFK 632 A PG T+ LTCE P+P +HW K Sbjct: 248 AVAPGGTVTLTCEVPAQPSPQIHWMK 273 >AJ277892-2|CAD12456.1|30017|Homo sapiens Titin protein. Length = 30000 Score = 36.7 bits (81), Expect = 0.068 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 8/132 (6%) Frame = +3 Query: 261 YLRKIFTVNIVAAEIS----SPEGALEFF---LRESHQYYRAVVRMHLVLLFTVAAL-LG 416 ++ K+ ++ +VA E + S EGA F L+E + R + + + VA L Sbjct: 6539 FVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFA 6598 Query: 417 SCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEA 596 + A+ K+I + + D +E + + GP+ T G T L C+ Sbjct: 6599 KAEPANAGKYICQIKN-DGGMEENMATLMVLEPAVIVEKAGPMTV---TVGETCTLECKV 6654 Query: 597 AGSPAPSVHWFK 632 AG+P SV W+K Sbjct: 6655 AGTPELSVEWYK 6666 Score = 33.9 bits (74), Expect = 0.48 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PSY PG + L C+ GSP V WFK Sbjct: 4672 PSYLMLPGESARLHCKLKGSPVIQVTWFK 4700 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GT+++L +G PAP++ W+K Sbjct: 27814 GTSVKLRAGISGKPAPTIEWYK 27835 >M97675-1|AAA60275.1| 937|Homo sapiens transmembrane receptor protein. Length = 937 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >BC128386-1|AAI28387.1| 940|Homo sapiens ROR1 protein protein. Length = 940 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 60 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 96 >BC080541-1|AAH80541.1| 393|Homo sapiens ROR1 protein protein. Length = 393 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >BC030143-1|AAH30143.1| 813|Homo sapiens mucosa associated lymphoid tissue lymphoma translocation gene 1 protein. Length = 813 Score = 36.3 bits (80), Expect = 0.090 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = +3 Query: 462 DIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 DI S + V S+ L I P S PG+T+ L C A GSP P WFK Sbjct: 210 DIPESFQRSVDGVSESK---LQICVEPT-SQKLMPGSTLVLQCVAVGSPIPHYQWFK 262 >AL445205-2|CAH71706.1| 937|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 937 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >AL445205-1|CAH71705.1| 393|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 393 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >AL161742-2|CAI21932.1| 937|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 937 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >AL161742-1|CAI21931.1| 393|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 393 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >AL137859-2|CAI21732.1| 937|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 937 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >AL137859-1|CAC17591.2| 393|Homo sapiens receptor tyrosine kinase-like orphan receptor 1 protein. Length = 393 Score = 36.3 bits (80), Expect = 0.090 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 519 YLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 YL++ + P+ + + G T EL C+ +G+P P++ WFK Sbjct: 57 YLTLDE-PMNNITTSLGQTAELHCKVSGNPPPTIRWFK 93 >AF316597-1|AAG38589.1| 824|Homo sapiens paracaspase protein. Length = 824 Score = 36.3 bits (80), Expect = 0.090 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = +3 Query: 462 DIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 DI S + V S+ L I P S PG+T+ L C A GSP P WFK Sbjct: 210 DIPESFQRSVDGVSESK---LQICVEPT-SQKLMPGSTLVLQCVAVGSPIPHYQWFK 262 >AF130356-1|AAD38507.2| 824|Homo sapiens MALT lymphoma associated translocation protein. Length = 824 Score = 36.3 bits (80), Expect = 0.090 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = +3 Query: 462 DIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 DI S + V S+ L I P S PG+T+ L C A GSP P WFK Sbjct: 210 DIPESFQRSVDGVSESK---LQICVEPT-SQKLMPGSTLVLQCVAVGSPIPHYQWFK 262 >AF123094-1|AAD46161.1| 1140|Homo sapiens API2-MLT fusion protein protein. Length = 1140 Score = 36.3 bits (80), Expect = 0.090 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = +3 Query: 462 DIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 DI S + V S+ L I P S PG+T+ L C A GSP P WFK Sbjct: 526 DIPESFQRSVDGVSESK---LQICVEPT-SQKLMPGSTLVLQCVAVGSPIPHYQWFK 578 >AB026118-1|BAA83099.1| 813|Homo sapiens MALT1 protein. Length = 813 Score = 36.3 bits (80), Expect = 0.090 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = +3 Query: 462 DIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 DI S + V S+ L I P S PG+T+ L C A GSP P WFK Sbjct: 210 DIPESFQRSVDGVSESK---LQICVEPT-SQKLMPGSTLVLQCVAVGSPIPHYQWFK 262 >AL834139-1|CAD38854.1| 1340|Homo sapiens hypothetical protein protein. Length = 1340 Score = 35.5 bits (78), Expect = 0.16 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 492 QAKSDGSHKYLSITQGPLPSYAHTP-GTTIELTCEAAGSPAPSVHWFK 632 QA S K + QG SY P G +I+L C G P P +HW K Sbjct: 1104 QAVSFVHVKEAPVLQGEAFSYLVEPVGGSIQLDCVVRGDPVPDIHWIK 1151 Score = 35.1 bits (77), Expect = 0.21 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 TPG +EL C+A G+P P++ W K Sbjct: 419 TPGAPMELLCDAQGTPQPNITWHK 442 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 + + LP + T G+ L C+A GSP P++ W K Sbjct: 936 VIENGLPDLSTTEGSHAFLPCKARGSPEPNITWDK 970 Score = 31.5 bits (68), Expect = 2.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G+ + LTC+ +G PAP+V W K Sbjct: 52 GSPLVLTCDVSGVPAPTVTWLK 73 >M85289-1|AAA52700.1| 4391|Homo sapiens heparan sulfate proteoglycan protein. Length = 4391 Score = 35.1 bits (77), Expect = 0.21 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C A GSPAP++HW K Sbjct: 3226 GHTATLRCSATGSPAPTIHWSK 3247 Score = 30.7 bits (66), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHW 626 P PG E C A GSP P++ W Sbjct: 1873 PQLTVQPGQLAEFRCSATGSPTPTLEW 1899 >BC066363-1|AAH66363.1| 1805|Homo sapiens SDK2 protein protein. Length = 1805 Score = 35.1 bits (77), Expect = 0.21 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +IT+GPL S G ++ L CE +G+P P++ W K Sbjct: 36 NITRGPLDSTV-IDGMSVVLACETSGAPRPAITWQK 70 >AL590556-2|CAH71870.1| 4391|Homo sapiens heparan sulfate proteoglycan 2 protein. Length = 4391 Score = 35.1 bits (77), Expect = 0.21 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C A GSPAP++HW K Sbjct: 3226 GHTATLRCSATGSPAPTIHWSK 3247 Score = 30.7 bits (66), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHW 626 P PG E C A GSP P++ W Sbjct: 1873 PQLTVQPGQLAEFRCSATGSPTPTLEW 1899 >AL590103-2|CAI12125.1| 4391|Homo sapiens heparan sulfate proteoglycan 2 protein. Length = 4391 Score = 35.1 bits (77), Expect = 0.21 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C A GSPAP++HW K Sbjct: 3226 GHTATLRCSATGSPAPTIHWSK 3247 Score = 30.7 bits (66), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHW 626 P PG E C A GSP P++ W Sbjct: 1873 PQLTVQPGQLAEFRCSATGSPTPTLEW 1899 >AL445795-1|CAC18534.1| 4370|Homo sapiens heparan sulfate proteoglycan perlecan protein. Length = 4370 Score = 35.1 bits (77), Expect = 0.21 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C A GSPAP++HW K Sbjct: 3205 GHTATLRCSATGSPAPTIHWSK 3226 Score = 30.7 bits (66), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHW 626 P PG E C A GSP P++ W Sbjct: 1852 PQLTVQPGQLAEFRCSATGSPTPTLEW 1878 >AB209851-1|BAD93088.1| 2331|Homo sapiens Basement membrane-specific heparan sulfate proteoglycan core protein precursor protein. Length = 2331 Score = 35.1 bits (77), Expect = 0.21 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C A GSPAP++HW K Sbjct: 1166 GHTATLRCSATGSPAPTIHWSK 1187 >AB040947-1|BAA96038.1| 1598|Homo sapiens KIAA1514 protein protein. Length = 1598 Score = 35.1 bits (77), Expect = 0.21 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 +IT+GPL S G ++ L CE +G+P P++ W K Sbjct: 80 NITRGPLDSTV-IDGMSVVLACETSGAPRPAITWQK 114 >X90569-1|CAA62189.1| 7962|Homo sapiens elastic titin protein. Length = 7962 Score = 34.7 bits (76), Expect = 0.28 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 8/132 (6%) Frame = +3 Query: 261 YLRKIFTVNIVAAEIS----SPEGALEFF---LRESHQYYRAVVRMHLVLLFTVAAL-LG 416 ++ K+ ++ +VA E + S EGA F L+E + R + + + VA L Sbjct: 2277 FVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFA 2336 Query: 417 SCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEA 596 + A+ K+I + + D + + + GP+ T G T L C+ Sbjct: 2337 KAEPANAGKYICQIKN-DGGMRENMATLMVLEPAVIVEKAGPMTV---TVGETCTLECKV 2392 Query: 597 AGSPAPSVHWFK 632 AG+P SV W+K Sbjct: 2393 AGTPELSVEWYK 2404 Score = 33.9 bits (74), Expect = 0.48 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PSY PG + L C+ GSP V WFK Sbjct: 410 PSYLMLPGESARLHCKLKGSPVIQVTWFK 438 >X61656-1|CAA43837.1| 1354|Homo sapiens membrane protein protein. Length = 1354 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 537 GPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 G L + + G +IE++C A+G+P P + WFK Sbjct: 669 GNLENQTTSIGESIEVSCTASGNPPPQIMWFK 700 >L04947-1|AAA59459.1| 1354|Homo sapiens receptor tyrosine kinase protein. Length = 1354 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 537 GPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 G L + + G +IE++C A+G+P P + WFK Sbjct: 669 GNLENQTTSIGESIEVSCTASGNPPPQIMWFK 700 >BX928748-1|CAH74051.1| 5635|Homo sapiens protein ( Human DNA sequence from clone RP11-465I11 on chromosome 1 Contains part of the gene for hemicentin (FIBL-6). ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >BC131822-1|AAI31823.1| 1356|Homo sapiens kinase insert domain receptor (a type III receptor tyrosine kinase) protein. Length = 1356 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 537 GPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 G L + + G +IE++C A+G+P P + WFK Sbjct: 671 GNLENQTTSIGESIEVSCTASGNPPPQIMWFK 702 >AY942196-1|AAX20110.1| 385|Homo sapiens basigin (OK blood group) protein. Length = 385 Score = 34.7 bits (76), Expect = 0.28 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 507 GSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 G+ Q PL S G ++EL CEA GSP P + W+ Sbjct: 18 GASGAAGFVQAPL-SQQRWVGGSVELHCEAVGSPVPEIQWW 57 >AY358113-1|AAQ88480.1| 385|Homo sapiens EMMPRIN protein. Length = 385 Score = 34.7 bits (76), Expect = 0.28 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 507 GSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 G+ Q PL S G ++EL CEA GSP P + W+ Sbjct: 18 GASGAAGFVQAPL-SQQRWVGGSVELHCEAVGSPVPEIQWW 57 >AL391824-1|CAI17865.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-268N14 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AL135797-1|CAI17871.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-77J13 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AL135796-1|CAI17854.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-164L12 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AL133553-2|CAI17858.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-174L6 on chromosome 1 Contains the3' end of the gene for hemicentin, the PRG4 gene for proteoglycan 4 ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AL133515-1|CAI17853.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-153O3 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AL121996-1|CAI17844.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-118G19 on chromosome 1q25.1-31.1 Contains the 5' end of the gene for hemicentin. ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AL118512-1|CAI17864.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-248A21 on chromosome 1q31.1-31.3 Contains part of the gene for hemicentin (FIBL-6). ). Length = 5635 Score = 34.7 bits (76), Expect = 0.28 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS+ WFK Sbjct: 2403 SVSLTCEASGIPLPSITWFK 2422 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2305 TRGKSISLECEVQGIPPPTVTWMK 2328 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3916 ITCTASGVPFPSIHWTK 3932 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 570 TTIELTCEAAGSPAPSVHWFK 632 T+I + C A G+P P ++W K Sbjct: 3358 TSINIECRATGTPPPQINWLK 3378 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3546 LELTCIASGIPAPKMTWMK 3564 >AF548371-1|AAN40694.1| 385|Homo sapiens basigin long isoform protein. Length = 385 Score = 34.7 bits (76), Expect = 0.28 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 507 GSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 G+ Q PL S G ++EL CEA GSP P + W+ Sbjct: 18 GASGAAGFVQAPL-SQQRWVGGSVELHCEAVGSPVPEIQWW 57 >AF063658-1|AAC16450.1| 1356|Homo sapiens vascular endothelial growth factor receptor 2 protein. Length = 1356 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 537 GPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 G L + + G +IE++C A+G+P P + WFK Sbjct: 671 GNLENQTTSIGESIEVSCTASGNPPPQIMWFK 702 >AF035121-1|AAB88005.1| 1356|Homo sapiens KDR/flk-1 protein protein. Length = 1356 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 537 GPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 G L + + G +IE++C A+G+P P + WFK Sbjct: 671 GNLENQTTSIGESIEVSCTASGNPPPQIMWFK 702 >AB209901-1|BAD93138.1| 1451|Homo sapiens kinase insert domain receptor (a type III receptor tyrosine kinase) variant protein. Length = 1451 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 537 GPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 G L + + G +IE++C A+G+P P + WFK Sbjct: 766 GNLENQTTSIGESIEVSCTASGNPPPQIMWFK 797 >Y13901-1|CAA74200.1| 802|Homo sapiens fibroblast growth factor 4 protein. Length = 802 Score = 34.3 bits (75), Expect = 0.36 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%) Frame = +3 Query: 294 AAEISSPEGALEF--FLRESHQYYRAVVRMHLVLLFTVAALLG-SCQSAHLNKHIKLLSD 464 A + G LE FL E Y + R +++L + + G S S++ ++ K D Sbjct: 76 AGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRD 135 Query: 465 IDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 + N QA + + +P+ G T++ C AAG+P P++ W K Sbjct: 136 LSNRHSYPQQAPYWTHPQRMEKKLHAVPA-----GNTVKFRCPAAGNPTPTIRWLK 186 >U27266-1|AAB86737.1| 477|Homo sapiens myosin binding protein H protein. Length = 477 Score = 34.3 bits (75), Expect = 0.36 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + TPG + +L C SP P + W K Sbjct: 383 SFTQ-PLADHTSTPGYSTQLFCSVRASPKPKIIWMK 417 >EF571596-1|ABQ01235.1| 802|Homo sapiens fibroblast growth factor receptor 4 protein. Length = 802 Score = 34.3 bits (75), Expect = 0.36 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%) Frame = +3 Query: 294 AAEISSPEGALEF--FLRESHQYYRAVVRMHLVLLFTVAALLG-SCQSAHLNKHIKLLSD 464 A + G LE FL E Y + R +++L + + G S S++ ++ K D Sbjct: 76 AGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRD 135 Query: 465 IDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 + N QA + + +P+ G T++ C AAG+P P++ W K Sbjct: 136 LSNRHSYPQQAPYWTHPQRMEKKLHAVPA-----GNTVKFRCPAAGNPTPTIRWLK 186 >BC071561-1|AAH71561.1| 1070|Homo sapiens LRIG1 protein protein. Length = 1070 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL + G T+ L C+A G+P P + WFK Sbjct: 675 PLEDRVVSVGETVALQCKATGNPPPRITWFK 705 >BC067101-1|AAH67101.1| 1212|Homo sapiens MYOM3 protein protein. Length = 1212 Score = 34.3 bits (75), Expect = 0.36 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL S+A TT+ LTC SP P V W+K Sbjct: 159 PLRSHAVWEHTTVLLTCTVQASPPPQVTWYK 189 >BC044226-1|AAH44226.1| 477|Homo sapiens myosin binding protein H protein. Length = 477 Score = 34.3 bits (75), Expect = 0.36 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + TPG + +L C SP P + W K Sbjct: 383 SFTQ-PLADHTSTPGYSTQLFCSVRASPKPKIIWMK 417 >BC014276-1|AAH14276.2| 417|Homo sapiens LRIG1 protein protein. Length = 417 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL + G T+ L C+A G+P P + WFK Sbjct: 22 PLEDRVVSVGETVALQCKATGNPPPRITWFK 52 >AY730707-1|AAU44786.1| 1093|Homo sapiens leucine-rich repeat protein LRIG1 protein. Length = 1093 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL + G T+ L C+A G+P P + WFK Sbjct: 698 PLEDRVVSVGETVALQCKATGNPPPRITWFK 728 >AL591178-3|CAH72090.1| 1437|Homo sapiens myomesin family, member 3 protein. Length = 1437 Score = 34.3 bits (75), Expect = 0.36 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL S+A TT+ LTC SP P V W+K Sbjct: 159 PLRSHAVWEHTTVLLTCTVQASPPPQVTWYK 189 >AL117666-1|CAB56036.1| 483|Homo sapiens hypothetical protein protein. Length = 483 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL + G T+ L C+A G+P P + WFK Sbjct: 88 PLEDRVVSVGETVALQCKATGNPPPRITWFK 118 >AJ410920-1|CAC39388.1| 96|Homo sapiens immunoglobulin lambda chain variable region protein. Length = 96 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS + +PG T +TC+ A S A VHW++ Sbjct: 8 PSVSVSPGQTASITCQGASSGANWVHWYQ 36 >AF487555-1|AAM13666.1| 802|Homo sapiens fibroblast growth factor receptor 4 protein. Length = 802 Score = 34.3 bits (75), Expect = 0.36 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%) Frame = +3 Query: 294 AAEISSPEGALEF--FLRESHQYYRAVVRMHLVLLFTVAALLG-SCQSAHLNKHIKLLSD 464 A + G LE FL E Y + R +++L + + G S S++ ++ K D Sbjct: 76 AGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRD 135 Query: 465 IDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 + N QA + + +P+ G T++ C AAG+P P++ W K Sbjct: 136 LSNRHSYPQQAPYWTHPQRMEKKLHAVPA-----GNTVKFRCPAAGNPTPTIRWLK 186 >AF381545-1|AAK62357.1| 1093|Homo sapiens membrane glycoprotein LRIG1 protein. Length = 1093 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL + G T+ L C+A G+P P + WFK Sbjct: 698 PLEDRVVSVGETVALQCKATGNPPPRITWFK 728 >AF202063-1|AAF27432.1| 762|Homo sapiens fibroblast growth factor receptor 4, soluble-form splice variant protein. Length = 762 Score = 34.3 bits (75), Expect = 0.36 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%) Frame = +3 Query: 294 AAEISSPEGALEF--FLRESHQYYRAVVRMHLVLLFTVAALLG-SCQSAHLNKHIKLLSD 464 A + G LE FL E Y + R +++L + + G S S++ ++ K D Sbjct: 76 AGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSSTSSNDDEDPKSHRD 135 Query: 465 IDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 + N QA + + +P+ G T++ C AAG+P P++ W K Sbjct: 136 LSNRHSYPQQAPYWTHPQRMEKKLHAVPA-----GNTVKFRCPAAGNPTPTIRWLK 186 >AB050468-1|BAB40659.1| 1094|Homo sapiens membrane glycoprotein LIG-1 protein. Length = 1094 Score = 34.3 bits (75), Expect = 0.36 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL + G T+ L C+A G+P P + WFK Sbjct: 698 PLEDRVVSVGETVALQCKATGNPPPRITWFK 728 >X76132-1|CAA53735.1| 1447|Homo sapiens tumour suppressor protein. Length = 1447 Score = 33.5 bits (73), Expect = 0.64 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +3 Query: 456 LSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L D + I + G ++LS T+ S G T+ L CE G P P++HW K Sbjct: 121 LGDSGSIISRTAKVAVAGPLRFLSQTE----SVTAFMGDTVLLKCEVIGEPMPTIHWQK 175 >M32292-1|AAA35751.1| 750|Homo sapiens protein ( Human colorectal tumor suppressor mRNA (DCC), 5' end. ). Length = 750 Score = 33.5 bits (73), Expect = 0.64 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +3 Query: 456 LSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L D + I + G ++LS T+ S G T+ L CE G P P++HW K Sbjct: 121 LGDSGSIISRTAKVAVAGPLRFLSQTE----SVTAFMGDTVLLKCEVIGEPMPTIHWQK 175 >BC117674-1|AAI17675.2| 1240|Homo sapiens NFASC protein protein. Length = 1240 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 42 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 75 >BC036524-1|AAH36524.1| 772|Homo sapiens DCC protein protein. Length = 772 Score = 33.5 bits (73), Expect = 0.64 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +3 Query: 456 LSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L D + I + G ++LS T+ S G T+ L CE G P P++HW K Sbjct: 55 LGDSGSIISRTAKVAVAGPLRFLSQTE----SVTAFMGDTVLLKCEVIGEPMPTIHWQK 109 >BC013867-1|AAH13867.2| 510|Homo sapiens PALLD protein protein. Length = 510 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L Y G + TC AG+P P ++WFK Sbjct: 134 LKHYKIFEGMPVTFTCRVAGNPKPKIYWFK 163 >BC010423-1|AAH10423.1| 510|Homo sapiens PVRL4 protein protein. Length = 510 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P P+ G T+ +C A GSPAPSV W Sbjct: 155 PGPALEEGQGLTLAASCTAEGSPAPSVTW 183 >AY211921-1|AAO65174.1| 294|Homo sapiens sarcoma antigen NY-SAR-77 protein. Length = 294 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L Y G + TC AG+P P ++WFK Sbjct: 136 LKHYKIFEGMPVTFTCRVAGNPKPKIYWFK 165 >AL834247-1|CAD38923.2| 1391|Homo sapiens hypothetical protein protein. Length = 1391 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + T G+ + TC+ G P P V+WFK Sbjct: 1022 LKHFRVTEGSPVTFTCKIVGIPVPKVYWFK 1051 >AL832379-1|CAD91155.1| 1045|Homo sapiens hypothetical protein protein. Length = 1045 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + T G+ + TC+ G P P V+WFK Sbjct: 676 LKHFRVTEGSPVTFTCKIVGIPVPKVYWFK 705 >AL832002-1|CAD89906.1| 1320|Homo sapiens hypothetical protein protein. Length = 1320 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + T G+ + TC+ G P P V+WFK Sbjct: 951 LKHFRVTEGSPVTFTCKIVGIPVPKVYWFK 980 >AL591806-13|CAI15376.1| 510|Homo sapiens poliovirus receptor-related 4 protein. Length = 510 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P P+ G T+ +C A GSPAPSV W Sbjct: 155 PGPALEEGQGLTLAASCTAEGSPAPSVTW 183 >AL512429-2|CAH73748.1| 1320|Homo sapiens sarcomeric protein myopalladin, 145 kDa (MYOP) protein. Length = 1320 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + T G+ + TC+ G P P V+WFK Sbjct: 951 LKHFRVTEGSPVTFTCKIVGIPVPKVYWFK 980 >AL512429-1|CAH73747.1| 1045|Homo sapiens sarcomeric protein myopalladin, 145 kDa (MYOP) protein. Length = 1045 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + T G+ + TC+ G P P V+WFK Sbjct: 676 LKHFRVTEGSPVTFTCKIVGIPVPKVYWFK 705 >AL391822-8|CAI14664.1| 1040|Homo sapiens neurofascin homolog (chicken) protein. Length = 1040 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 11 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 44 >AL391822-7|CAI14662.1| 1165|Homo sapiens neurofascin homolog (chicken) protein. Length = 1165 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 12 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 45 >AL391822-6|CAI14658.1| 1174|Homo sapiens neurofascin homolog (chicken) protein. Length = 1174 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 36 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 69 >AL391822-5|CAI14660.1| 1347|Homo sapiens neurofascin homolog (chicken) protein. Length = 1347 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 42 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 75 >AL391822-4|CAI14661.1| 1157|Homo sapiens neurofascin homolog (chicken) protein. Length = 1157 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 36 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 69 >AL391822-3|CAI14659.1| 1240|Homo sapiens neurofascin homolog (chicken) protein. Length = 1240 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 42 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 75 >AL391822-2|CAI14657.1| 619|Homo sapiens neurofascin homolog (chicken) protein. Length = 619 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 42 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 75 >AL391822-1|CAI14656.1| 302|Homo sapiens neurofascin homolog (chicken) protein. Length = 302 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 42 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 75 >AK027753-1|BAB55344.1| 510|Homo sapiens protein ( Homo sapiens cDNA FLJ14847 fis, clone PLACE1000401, weakly similar to POLIOVIRUS RECEPTOR PRECURSOR. ). Length = 510 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P P+ G T+ +C A GSPAPSV W Sbjct: 155 PGPALEEGQGLTLAASCTAEGSPAPSVTW 183 >AF464873-1|AAL69964.1| 1106|Homo sapiens myoneurin protein. Length = 1106 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L Y G + TC AG+P P ++WFK Sbjct: 783 LKHYKIFEGMPVTFTCRVAGNPKPKIYWFK 812 >AF426163-1|AAL23958.1| 510|Homo sapiens nectin 4 protein. Length = 510 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P P+ G T+ +C A GSPAPSV W Sbjct: 155 PGPALEEGQGLTLAASCTAEGSPAPSVTW 183 >AF328296-1|AAK50625.1| 1320|Homo sapiens myopalladin protein. Length = 1320 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L + T G+ + TC+ G P P V+WFK Sbjct: 951 LKHFRVTEGSPVTFTCKIVGIPVPKVYWFK 980 >AF160477-1|AAF82399.1| 510|Homo sapiens Ig superfamily receptor LNIR precursor protein. Length = 510 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P P+ G T+ +C A GSPAPSV W Sbjct: 155 PGPALEEGQGLTLAASCTAEGSPAPSVTW 183 >AF156100-1|AAK68690.1| 5636|Homo sapiens hemicentin protein. Length = 5636 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 573 TIELTCEAAGSPAPSVHWFK 632 ++ LTCEA+G P PS WFK Sbjct: 2404 SVSLTCEASGIPLPSTTWFK 2423 Score = 31.1 bits (67), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L C+ G+P P +HWFK Sbjct: 1471 VALECQVKGTPFPDIHWFK 1489 Score = 30.3 bits (65), Expect = 5.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 ++L C+AAG+P P + W+K Sbjct: 1938 VQLECKAAGNPVPVITWYK 1956 Score = 30.3 bits (65), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G +I L CE G P P+V W K Sbjct: 2306 TRGKSISLECEVQGIPPPTVTWMK 2329 Score = 30.3 bits (65), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 582 LTCEAAGSPAPSVHWFK 632 +TC A+G P PS+HW K Sbjct: 3917 ITCTASGVPFPSIHWTK 3933 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 + L CEA G PAPS+ W K Sbjct: 2029 VRLECEARGIPAPSLTWLK 2047 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 576 IELTCEAAGSPAPSVHWFK 632 +ELTC A+G PAP + W K Sbjct: 3547 LELTCIASGIPAPKMTWMK 3565 >AF151909-1|AAD34146.1| 404|Homo sapiens CGI-151 protein protein. Length = 404 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L Y G + TC AG+P P ++WFK Sbjct: 28 LKHYKIFEGMPVTFTCRVAGNPKPKIYWFK 57 >AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. Length = 772 Score = 33.5 bits (73), Expect = 0.64 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 543 LPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L Y G + TC AG+P P ++WFK Sbjct: 396 LKHYKIFEGMPVTFTCRVAGNPKPKIYWFK 425 >AB018299-1|BAA34476.3| 1222|Homo sapiens KIAA0756 protein protein. Length = 1222 Score = 33.5 bits (73), Expect = 0.64 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 +IT+ + P I + CEA G+PAPS HW Sbjct: 89 TITKQSAKDHIVDPRDNILIECEAKGNPAPSFHW 122 >X57205-1|CAA40490.1| 802|Homo sapiens fibroblast growth factor receptor protein. Length = 802 Score = 33.1 bits (72), Expect = 0.84 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 552 YAHTPGTTIELTCEAAGSPAPSVHWFK 632 +A G T++ C AAG+P P++ W K Sbjct: 160 HAVPAGNTVKFRCPAAGNPTPTIRWLK 186 >L03840-1|AAB59389.1| 802|Homo sapiens fibroblast growth factor receptor 4 protein. Length = 802 Score = 33.1 bits (72), Expect = 0.84 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 552 YAHTPGTTIELTCEAAGSPAPSVHWFK 632 +A G T++ C AAG+P P++ W K Sbjct: 160 HAVPAGNTVKFRCPAAGNPTPTIRWLK 186 >BC011847-1|AAH11847.1| 802|Homo sapiens fibroblast growth factor receptor 4 protein. Length = 802 Score = 33.1 bits (72), Expect = 0.84 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 552 YAHTPGTTIELTCEAAGSPAPSVHWFK 632 +A G T++ C AAG+P P++ W K Sbjct: 160 HAVPAGNTVKFRCPAAGNPTPTIRWLK 186 >AY928131-1|AAY16611.1| 127|Homo sapiens immunoglobulin lambda light chain protein. Length = 127 Score = 33.1 bits (72), Expect = 0.84 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS + PG T +TCE SVHWF+ Sbjct: 9 PSVSLAPGKTARITCEGENIGRKSVHWFQ 37 >AB209631-1|BAD92868.1| 1034|Homo sapiens Fibroblast growth factor receptor 4 variant protein. Length = 1034 Score = 33.1 bits (72), Expect = 0.84 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 552 YAHTPGTTIELTCEAAGSPAPSVHWFK 632 +A G T++ C AAG+P P++ W K Sbjct: 275 HAVPAGNTVKFRCPAAGNPTPTIRWLK 301 >BC117370-1|AAI17371.1| 1065|Homo sapiens leucine-rich repeats and immunoglobulin-like domains 2 protein. Length = 1065 Score = 32.7 bits (71), Expect = 1.1 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL T G T L C A GSPAP ++W K Sbjct: 701 PLEDKTVTRGETAVLQCIAGGSPAPRLNWTK 731 >BC117368-1|AAI17369.1| 1065|Homo sapiens leucine-rich repeats and immunoglobulin-like domains 2 protein. Length = 1065 Score = 32.7 bits (71), Expect = 1.1 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL T G T L C A GSPAP ++W K Sbjct: 701 PLEDKTVTRGETAVLQCIAGGSPAPRLNWTK 731 >BC114435-1|AAI14436.1| 1264|Homo sapiens Cdon homolog (mouse) protein. Length = 1264 Score = 32.7 bits (71), Expect = 1.1 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 516 KYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 ++ SI++G L + G T+ TC+ G+PAP+ WF Sbjct: 310 EHASISKG-LQDQIVSLGATVHFTCDVHGNPAPNCTWF 346 Score = 30.3 bits (65), Expect = 5.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 489 VQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 ++ ++DG K + IT P+ + G + L+C A+G P P + W+ Sbjct: 395 LEIENDGGFKPVIIT-APVSAKV-ADGDFVTLSCNASGLPVPVIRWY 439 >BC098583-1|AAH98583.1| 1287|Homo sapiens Cdon homolog (mouse) protein. Length = 1287 Score = 32.7 bits (71), Expect = 1.1 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 516 KYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 ++ SI++G L + G T+ TC+ G+PAP+ WF Sbjct: 310 EHASISKG-LQDQIVSLGATVHFTCDVHGNPAPNCTWF 346 Score = 30.3 bits (65), Expect = 5.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 489 VQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 ++ ++DG K + IT P+ + G + L+C A+G P P + W+ Sbjct: 395 LEIENDGGFKPVIIT-APVSAKV-ADGDFVTLSCNASGLPVPVIRWY 439 >AL357055-1|CAH73254.1| 1065|Homo sapiens leucine-rich repeats and immunoglobulin-like domains 2 protein. Length = 1065 Score = 32.7 bits (71), Expect = 1.1 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL T G T L C A GSPAP ++W K Sbjct: 701 PLEDKTVTRGETAVLQCIAGGSPAPRLNWTK 731 >AF060139-1|AAC15212.1| 108|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 108 Score = 32.7 bits (71), Expect = 1.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS + PG T +TCE + SVHW++ Sbjct: 8 PSVSVAPGKTATITCEGINIASKSVHWYQ 36 >AF004841-1|AAC34901.2| 1264|Homo sapiens CDO protein. Length = 1264 Score = 32.7 bits (71), Expect = 1.1 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 516 KYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 ++ SI++G L + G T+ TC+ G+PAP+ WF Sbjct: 310 EHASISKG-LQDQIVSLGATVHFTCDVHGNPAPNCTWF 346 Score = 30.3 bits (65), Expect = 5.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 489 VQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWF 629 ++ ++DG K + IT P+ + G + L+C A+G P P + W+ Sbjct: 395 LEIENDGGFKPVIIT-APVSAKV-ADGDFVTLSCNASGLPVPVIRWY 439 >AB018349-1|BAA34526.2| 1073|Homo sapiens KIAA0806 protein protein. Length = 1073 Score = 32.7 bits (71), Expect = 1.1 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PL T G T L C A GSPAP ++W K Sbjct: 709 PLEDKTVTRGETAVLQCIAGGSPAPRLNWTK 739 >Y10129-1|CAA71216.1| 1274|Homo sapiens myosin binding protein C gene protein. Length = 1274 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1182 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216 >X90568-1|CAA62188.1|26926|Homo sapiens titin protein. Length = 26926 Score = 32.3 bits (70), Expect = 1.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + TCE +G P+P + WFK Sbjct: 26651 GQNVLFTCEISGEPSPEIEWFK 26672 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GT+++L +G PAP++ W+K Sbjct: 20390 GTSVKLRAGISGKPAPTIEWYK 20411 >X84075-1|CAA58882.1| 1274|Homo sapiens cardiac myosin-binding protein C protein. Length = 1274 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1182 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216 >U91629-1|AAC04620.1| 1274|Homo sapiens cardiac myosin binding protein-C protein. Length = 1274 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1182 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216 >M63702-1|AAA52179.1| 94|Homo sapiens DCC protein. Length = 94 Score = 32.3 bits (70), Expect = 1.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ L CE G P P++HW K Sbjct: 16 GDTVLLKCEVIGEPMPTIHWQK 37 >M32286-1|AAA52174.1| 53|Homo sapiens colorectal tumor suppressor protein. Length = 53 Score = 32.3 bits (70), Expect = 1.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ L CE G P P++HW K Sbjct: 16 GDTVLLKCEVIGEPMPTIHWQK 37 >EF560722-1|ABQ59032.1| 1274|Homo sapiens MYBPC3 protein protein. Length = 1274 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1182 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216 >BX538319-1|CAD98093.1| 1290|Homo sapiens hypothetical protein protein. Length = 1290 Score = 32.3 bits (70), Expect = 1.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I QGP+ GT + L+C A GSP P++ W K Sbjct: 92 IRQGPVNQTVAVDGTFV-LSCVATGSPVPTILWRK 125 >BC151211-1|AAI51212.1| 1274|Homo sapiens myosin binding protein C, cardiac protein. Length = 1274 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1182 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216 >BC142685-1|AAI42686.1| 1274|Homo sapiens myosin binding protein C, cardiac protein. Length = 1274 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1182 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216 >BC115022-1|AAI15023.1| 1551|Homo sapiens ROBO1 protein protein. Length = 1551 Score = 32.3 bits (70), Expect = 1.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I QGP+ GT + L+C A GSP P++ W K Sbjct: 421 IRQGPVNQTVAVDGTFV-LSCVATGSPVPTILWRK 454 >BC115020-1|AAI15021.1| 1606|Homo sapiens ROBO1 protein protein. Length = 1606 Score = 32.3 bits (70), Expect = 1.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I QGP+ GT + L+C A GSP P++ W K Sbjct: 421 IRQGPVNQTVAVDGTFV-LSCVATGSPVPTILWRK 454 >BC112336-1|AAI12337.1| 1607|Homo sapiens ROBO1 protein protein. Length = 1607 Score = 32.3 bits (70), Expect = 1.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I QGP+ GT + L+C A GSP P++ W K Sbjct: 421 IRQGPVNQTVAVDGTFV-LSCVATGSPVPTILWRK 454 >BC107797-1|AAI07798.1| 179|Homo sapiens TTN protein protein. Length = 179 Score = 32.3 bits (70), Expect = 1.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + TCE +G P+P + WFK Sbjct: 5 GQNVLFTCEISGEPSPEIEWFK 26 >BC067107-1|AAH67107.1| 814|Homo sapiens putative neuronal cell adhesion molecule protein. Length = 814 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S + GTT TC+A G P P V W K Sbjct: 338 SISRPAGTTAMFTCQAQGEPPPHVTWLK 365 >BC054883-1|AAH54883.1| 234|Homo sapiens Unknown (protein for MGC:62026) protein. Length = 234 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS + PG T +TC A A SVHW++ Sbjct: 27 PSVSVAPGKTARITCGADNIGAKSVHWYQ 55 >BC042054-1|AAH42054.1| 814|Homo sapiens putative neuronal cell adhesion molecule protein. Length = 814 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S + GTT TC+A G P P V W K Sbjct: 338 SISRPAGTTAMFTCQAQGEPPPHVTWLK 365 >BC036502-1|AAH36502.1| 847|Homo sapiens follistatin-like 5 protein. Length = 847 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S A PG T L C A G P P + W K Sbjct: 349 SQAREPGVTASLRCHAEGIPKPQLGWLK 376 >AY518390-1|AAR89909.1| 1273|Homo sapiens myosin binding protein C, cardiac protein. Length = 1273 Score = 32.3 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 525 SITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S TQ PL + + G T L C GSP P + WFK Sbjct: 1181 SFTQ-PLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1215 >AL713647-1|CAD28458.1| 1232|Homo sapiens hypothetical protein protein. Length = 1232 Score = 32.3 bits (70), Expect = 1.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + TCE +G P+P + WFK Sbjct: 957 GQNVLFTCEISGEPSPEIEWFK 978 >AL137695-1|CAB70877.1| 773|Homo sapiens hypothetical protein protein. Length = 773 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S A PG T L C A G P P + W K Sbjct: 275 SQAREPGVTASLRCHAEGIPKPQLGWLK 302 >AK093583-1|BAC04201.1| 329|Homo sapiens protein ( Homo sapiens cDNA FLJ36264 fis, clone THYMU2002815, weakly similar to AXONIN-1 PRECURSOR. ). Length = 329 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 + + LP + T G+ L C+A GSP P++ W K Sbjct: 170 VIENGLPDLSTTEGSHAFLPCKARGSPEPNITWDK 204 >AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein. Length = 26926 Score = 32.3 bits (70), Expect = 1.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G + TCE +G P+P + WFK Sbjct: 26651 GQNVLFTCEISGEPSPEIEWFK 26672 Score = 29.9 bits (64), Expect = 7.8 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GT+++L +G PAP++ W+K Sbjct: 20390 GTSVKLRAGISGKPAPTIEWYK 20411 >AF491813-1|AAM09558.1| 2113|Homo sapiens Down syndrome cell adhesion molecule 2 protein. Length = 2113 Score = 32.3 bits (70), Expect = 1.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+EL C A+G P P++ W K Sbjct: 300 GHTVELPCTASGYPIPAIRWLK 321 >AF334384-1|AAL57166.1| 2053|Homo sapiens Down syndrome cell adhesion molecule DSCAML1 protein. Length = 2053 Score = 32.3 bits (70), Expect = 1.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+EL C A+G P P++ W K Sbjct: 240 GHTVELPCTASGYPIPAIRWLK 261 >AF304304-1|AAN32613.1| 2053|Homo sapiens Down syndrome cell adhesion molecule like-protein 1a protein. Length = 2053 Score = 32.3 bits (70), Expect = 1.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+EL C A+G P P++ W K Sbjct: 240 GHTVELPCTASGYPIPAIRWLK 261 >AF040990-1|AAC39575.1| 1651|Homo sapiens roundabout 1 protein. Length = 1651 Score = 32.3 bits (70), Expect = 1.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 I QGP+ GT + L+C A GSP P++ W K Sbjct: 457 IRQGPVNQTVAVDGTFV-LSCVATGSPVPTILWRK 490 >AC079227-1|AAY40948.1| 274|Homo sapiens unknown protein. Length = 274 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S A PG T L C A G P P + W K Sbjct: 51 SQAREPGVTASLRCHAEGIPKPQLGWLK 78 >AB033089-1|BAA86577.1| 850|Homo sapiens KIAA1263 protein protein. Length = 850 Score = 32.3 bits (70), Expect = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S A PG T L C A G P P + W K Sbjct: 352 SQAREPGVTASLRCHAEGIPKPQLGWLK 379 >AB032958-1|BAA86446.2| 2092|Homo sapiens KIAA1132 protein protein. Length = 2092 Score = 32.3 bits (70), Expect = 1.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+EL C A+G P P++ W K Sbjct: 279 GHTVELPCTASGYPIPAIRWLK 300 >X69089-1|CAA48832.1| 1465|Homo sapiens 165kD protein protein. Length = 1465 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ LTC G+P P V WFK Sbjct: 1359 GKTLNLTCTVFGNPDPEVIWFK 1380 >U41725-1|AAD09360.1| 1502|Homo sapiens PTPsigma-(brain) protein. Length = 1502 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ PG + +TC A GSP P V W + Sbjct: 240 SHEIMPGGNVNITCVAVGSPMPYVKWMQ 267 >U40317-1|AAC50567.1| 1911|Homo sapiens PTPsigma protein. Length = 1911 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ PG + +TC A GSP P V W + Sbjct: 240 SHEIMPGGNVNITCVAVGSPMPYVKWMQ 267 >U35234-1|AAC50299.1| 1948|Homo sapiens protein tyrosine phosphatase sigma protein. Length = 1948 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ PG + +TC A GSP P V W + Sbjct: 253 SHEIMPGGNVNITCVAVGSPMPYVKWMQ 280 >L38929-1|AAC41749.1| 1912|Homo sapiens protein tyrosine phosphatase delta protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >BC130619-1|AAI30620.1| 1100|Homo sapiens CNTN5 protein protein. Length = 1100 Score = 31.9 bits (69), Expect = 1.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GTT+++ C A G+P P++ W K Sbjct: 315 GTTVKMECFALGNPVPTITWMK 336 >BC106716-1|AAI06717.1| 1496|Homo sapiens PTPRD protein protein. Length = 1496 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 235 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 263 >BC106715-1|AAI06716.1| 1505|Homo sapiens PTPRD protein protein. Length = 1505 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >BC106714-1|AAI06715.1| 1506|Homo sapiens PTPRD protein protein. Length = 1506 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >BC106713-1|AAI06714.1| 1505|Homo sapiens PTPRD protein protein. Length = 1505 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 231 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 259 >BC104812-1|AAI04813.1| 1501|Homo sapiens protein tyrosine phosphatase, receptor type, S protein. Length = 1501 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ PG + +TC A GSP P V W + Sbjct: 240 SHEIMPGGNVNITCVAVGSPMPYVKWMQ 267 >BC052969-1|AAH52969.1| 1465|Homo sapiens myomesin (M-protein) 2, 165kDa protein. Length = 1465 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T+ LTC G+P P V WFK Sbjct: 1359 GKTLNLTCTVFGNPDPEVIWFK 1380 >BC039255-1|AAH39255.1| 617|Homo sapiens CNTN5 protein protein. Length = 617 Score = 31.9 bits (69), Expect = 1.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GTT+++ C A G+P P++ W K Sbjct: 21 GTTVKMECFALGNPVPTITWMK 42 >AY369208-1|AAQ73312.1| 956|Homo sapiens MAM domain-containing glycosylphosphatidylinositol anchor 2 protein. Length = 956 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 552 YAHTPGTTIELTCEAAGSPAPSVHWFK 632 Y G T+ELTC G P P + W K Sbjct: 50 YTIREGETLELTCLVTGHPRPQIRWTK 76 >AY273815-1|AAQ16156.1| 2623|Homo sapiens bone specific CMF608 protein. Length = 2623 Score = 31.9 bits (69), Expect = 1.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G+T+EL C A G P+P+V W Sbjct: 1760 GSTVELKCRAEGRPSPTVTW 1779 Score = 31.1 bits (67), Expect = 3.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 I G S+ + L CEA G+P P++HW Sbjct: 1650 IVGGKAASFTIPANSDAFLPCEAVGNPLPTIHW 1682 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHW 626 T G +++L C A G+P PSV+W Sbjct: 1855 TWGESLKLPCTAKGTPQPSVYW 1876 >AL590397-1|CAH73128.2| 1912|Homo sapiens protein tyrosine phosphatase, receptor type, D protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >AL583805-2|CAH70443.2| 1912|Homo sapiens protein tyrosine phosphatase, receptor type, D protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >AL445926-1|CAH73847.2| 1912|Homo sapiens protein tyrosine phosphatase, receptor type, D protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >AL356584-1|CAI16146.2| 1912|Homo sapiens protein tyrosine phosphatase, receptor type, D protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >AL137125-1|CAH70912.2| 1912|Homo sapiens protein tyrosine phosphatase, receptor type, D protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >AL049946-1|CAB43220.1| 584|Homo sapiens hypothetical protein protein. Length = 584 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 IT P P PG T++L C A G P + W Sbjct: 491 ITSEPTPVIYTRPGNTVKLNCMAMGIPKADITW 523 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G TI L C AAG+P PS+ W Sbjct: 313 GHTISLNCSAAGTPTPSLVW 332 >AK128160-1|BAC87305.1| 632|Homo sapiens protein ( Homo sapiens cDNA FLJ46283 fis, clone TESTI4031173. ). Length = 632 Score = 31.9 bits (69), Expect = 1.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G+T+EL C A G P+P+V W Sbjct: 387 GSTVELKCRAEGRPSPTVTW 406 Score = 31.1 bits (67), Expect = 3.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 I G S+ + L CEA G+P P++HW Sbjct: 277 IVGGKAASFTIPANSDAFLPCEAVGNPLPTIHW 309 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHW 626 T G +++L C A G+P PSV+W Sbjct: 482 TWGESLKLPCTAKGTPQPSVYW 503 >AJ578212-1|CAE18213.1| 107|Homo sapiens immunoglobulin lambda-1 variable region protein. Length = 107 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS + PG T +TCE + SVHW++ Sbjct: 8 PSVSVAPGKTTTITCEGNNVGSKSVHWYQ 36 >AF245505-1|AAF86402.1| 2828|Homo sapiens adlican protein. Length = 2828 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 IT P P PG T++L C A G P + W Sbjct: 2735 ITSEPTPVIYTRPGNTVKLNCMAMGIPKADITW 2767 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G TI L C AAG+P PS+ W Sbjct: 2557 GHTISLNCSAAGTPTPSLVW 2576 Score = 30.3 bits (65), Expect = 5.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 528 ITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 I Q L + + PG +I + C A +P PSV W Sbjct: 2049 IHQEKLENISLPPGLSIHIHCTAKAAPLPSVRW 2081 >AF063726-1|AAC16807.1| 108|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 108 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 PS + PGTT +TC SVHW++ Sbjct: 8 PSVSAAPGTTATITCGGNNIETKSVHWYQ 36 >AC005338-1|AAC27825.1| 475|Homo sapiens PTPsigma, partial CDS protein. Length = 475 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ PG + +TC A GSP P V W + Sbjct: 114 SHEIMPGGNVNITCVAVGSPMPYVKWMQ 141 >AB211400-1|BAE79816.1| 1912|Homo sapiens protein tyrosine phosphatase receptor type D protein. Length = 1912 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 241 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 269 >AB209333-1|BAD92570.1| 1560|Homo sapiens protein tyrosine phosphatase, receptor type, sigma isoform 3 precursor variant protein. Length = 1560 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHWFK 632 S+ PG + +TC A GSP P V W + Sbjct: 266 SHEIMPGGNVNITCVAVGSPMPYVKWMQ 293 >AB208869-1|BAD92106.1| 1478|Homo sapiens protein tyrosine phosphatase, receptor type, D isoform 4 precursor variant protein. Length = 1478 Score = 31.9 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P ++ PG ++ +TC A GSP P V W Sbjct: 214 PPTNHEIMPGGSVNITCVAVGSPMPYVKW 242 >AB013803-1|BAA36580.2| 1026|Homo sapiens hNB-2s protein. Length = 1026 Score = 31.9 bits (69), Expect = 1.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GTT+++ C A G+P P++ W K Sbjct: 241 GTTVKMECFALGNPVPTITWMK 262 >AB013802-1|BAA36579.2| 1100|Homo sapiens hNB-2 protein. Length = 1100 Score = 31.9 bits (69), Expect = 1.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 GTT+++ C A G+P P++ W K Sbjct: 315 GTTVKMECFALGNPVPTITWMK 336 >Z29373-1|CAA82564.1| 1257|Homo sapiens neural cell adhesion molecule L1 protein. Length = 1257 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 435 TYMAVQGSTAYLLCKAFGAPVPSVQW 460 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 341 SHLYGPGETARLDCQVQGRPQPEVTW 366 >Y00815-1|CAA68754.1| 1897|Homo sapiens put. LAR preprotein (AA -16 to 1881) protein. Length = 1897 Score = 31.5 bits (68), Expect = 2.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 540 PLPSYAHTPGTTIELTCEAAGSPAPSVHW 626 P S PG ++ LTC A G+P P V W Sbjct: 227 PPSSQEVMPGGSVNLTCVAVGAPMPYVKW 255 Score = 30.3 bits (65), Expect = 5.9 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = +3 Query: 456 LSDIDNSIENGVQAKSDGSHKYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFK 632 L +I+ S + V + + SI GP T L C A G+P P + WFK Sbjct: 103 LGEINTSAKLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATML-CAAGGNPDPEISWFK 160 >X62515-1|CAA44373.1| 4393|Homo sapiens Human basement membrane heparan sulfate proteoglycan core protein protein. Length = 4393 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 567 GTTIELTCEAAGSPAPSVHWFK 632 G T L C A GSPA ++HW K Sbjct: 3228 GHTATLRCSATGSPARTIHWSK 3249 Score = 30.7 bits (66), Expect = 4.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 546 PSYAHTPGTTIELTCEAAGSPAPSVHW 626 P PG E C A GSP P++ W Sbjct: 1875 PQLTVQPGQLAEFRCSATGSPTPTLEW 1901 >X59847-1|CAA42508.1| 1257|Homo sapiens Neural cell adhesion molecule L1 protein. Length = 1257 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 435 TYMAVQGSTAYLLCKAFGAPVPSVQW 460 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 341 SHLYGPGETARLDCQVEGRPQPEVTW 366 >X58776-1|CAB37831.1| 824|Homo sapiens cell adhesion molecule L1 protein. Length = 824 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 83 TYMAVQGSTAYLLCKAFGAPVPSVQW 108 >X16455-1|CAA34474.1| 697|Homo sapiens pCEA80-11 protein (647 AA) protein. Length = 697 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 365 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 424 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 425 GVNLSLSCHAASNPPAQYSW 444 >M77640-1|AAC14352.1| 1257|Homo sapiens L1 cell adhesion molecule protein. Length = 1257 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 435 TYMAVQGSTAYLLCKAFGAPVPSVQW 460 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 341 SHLYGPGETARLDCQVQGRPQPEVTW 366 >M74387-1|AAA59476.1| 1253|Homo sapiens cell adhesion molecule L1 protein. Length = 1253 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 435 TYMAVQGSTAYLLCKAFGAPVPSVQW 460 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 341 SHLYGPGETARLDCQVQGRPQPEVTW 366 >M59262-1|AAA62835.1| 702|Homo sapiens carcinoembryonic antigen protein. Length = 702 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 370 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 429 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 430 GVNLSLSCHAASNPPAQYSW 449 >M29540-1|AAA51967.1| 702|Homo sapiens CEA protein. Length = 702 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 370 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 429 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 430 GVNLSLSCHAASNPPAQYSW 449 >M17303-1|AAB59513.1| 702|Homo sapiens CEA protein. Length = 702 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 370 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 429 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 430 GVNLSLSCHAASNPPAQYSW 449 >M17191-1|AAA51968.1| 287|Homo sapiens CEA protein. Length = 287 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 55 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 114 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 115 GVNLSLSCHAASNPPAQYSW 134 >M16234-1|AAA51972.1| 372|Homo sapiens CEA protein. Length = 372 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 40 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 99 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 100 GVNLSLSCHAASNPPAQYSW 119 >M15042-1|AAA51963.1| 698|Homo sapiens CEA protein. Length = 698 Score = 31.5 bits (68), Expect = 2.6 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%) Frame = +3 Query: 423 QSAHLNKHIKLLSDIDNSI---ENGVQAKSDGSHK---YLSITQGP-----LPSYAH-TP 566 Q ++ N+ + LLS N + E G+Q + H L++ GP PSY + P Sbjct: 366 QLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRP 425 Query: 567 GTTIELTCEAAGSPAPSVHW 626 G + L+C AA +P W Sbjct: 426 GVNLSLSCHAASNPPAQYSW 445 >EF506611-1|ABP88252.1| 1248|Homo sapiens non-neural L1CAM protein. Length = 1248 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 430 TYMAVQGSTAYLLCKAFGAPVPSVQW 455 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 336 SHLYGPGETARLDCQVQGRPQPEVTW 361 >D86983-1|BAA13219.1| 1496|Homo sapiens KIAA0230 protein. Length = 1496 Score = 31.5 bits (68), Expect = 2.6 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Frame = +3 Query: 504 DGSHKYLSITQGPLPSYAHTP-------GTTIELTCEAAGSPAPSVHWFK 632 D H I LP + TP G T++ CEA G+P P + W K Sbjct: 436 DSVHATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTK 485 Score = 30.7 bits (66), Expect = 4.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 561 TPGTTIELTCEAAGSPAPSVHWFK 632 T G T+ TC A G+P P + W + Sbjct: 275 TSGNTVYFTCRAEGNPKPEIIWLR 298 >DQ173642-2|ABC25979.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173641-2|ABC25974.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173640-2|ABC25969.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173639-2|ABC25964.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173638-2|ABC25959.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173637-2|ABC25954.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173636-2|ABC25949.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173635-2|ABC25944.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173634-2|ABC25939.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173633-2|ABC25934.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173632-2|ABC25929.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173631-2|ABC25924.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173630-2|ABC25919.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173629-2|ABC25914.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173628-2|ABC25909.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173627-2|ABC25904.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173626-2|ABC25899.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173625-2|ABC25894.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173624-2|ABC25889.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173623-2|ABC25884.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173622-2|ABC25879.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173621-2|ABC25874.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173620-2|ABC25869.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173619-2|ABC25864.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173618-2|ABC25859.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173617-2|ABC25854.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173616-2|ABC25849.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173615-2|ABC25844.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173614-2|ABC25839.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173613-2|ABC25834.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173612-2|ABC25829.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173611-2|ABC25824.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173610-2|ABC25819.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173609-2|ABC25814.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173608-2|ABC25809.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173607-2|ABC25804.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173606-2|ABC25799.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173605-2|ABC25794.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173604-2|ABC25789.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173603-2|ABC25784.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173602-2|ABC25779.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 >DQ173601-2|ABC25774.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 31.5 bits (68), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 +Y G+T L C+A G+P PSV W Sbjct: 267 TYMAVQGSTAYLLCKAFGAPVPSVQW 292 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 549 SYAHTPGTTIELTCEAAGSPAPSVHW 626 S+ + PG T L C+ G P P V W Sbjct: 173 SHLYGPGETARLDCQVQGRPQPEVTW 198 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,245,309 Number of Sequences: 237096 Number of extensions: 1838988 Number of successful extensions: 11819 Number of sequences better than 10.0: 498 Number of HSP's better than 10.0 without gapping: 9921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11819 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6916500330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -