BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a17 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0664 - 21659497-21659547,21659750-21659860,21659971-216600... 272 2e-73 07_01_1132 + 10531922-10532136,10532307-10532433,10532945-105331... 29 2.7 06_03_0615 - 22761375-22761760,22762218-22765026 29 4.8 02_05_0235 - 27068516-27069032,27069697-27069788,27070056-270702... 28 6.3 07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624,557... 28 8.3 04_04_0779 - 28023735-28024058,28024520-28024618,28024704-280249... 28 8.3 >12_02_0664 - 21659497-21659547,21659750-21659860,21659971-21660039, 21660442-21660513,21660669-21660749,21661256-21661348, 21661581-21661733,21661846-21661897,21662033-21662218, 21662830-21662949,21663059-21663297 Length = 408 Score = 272 bits (667), Expect = 2e-73 Identities = 121/203 (59%), Positives = 161/203 (79%), Gaps = 1/203 (0%) Frame = +2 Query: 98 EDEDFVDPWTVT-GKSDTGIDYDKLIKRFGSQKIDDELIQRFEKVIGRKAHHLLRRGIFF 274 E+E V+PW V+ GK GIDYDKL+ +FG Q++DD L+ R ++ R H LRRG+FF Sbjct: 20 EEEQVVNPWEVSAGKG--GIDYDKLVDQFGCQRLDDALVARVARLTARPPHRFLRRGLFF 77 Query: 275 SHRDLNVILNLHEAGKKFYLYTGRGPSSDSMHLGHMIPFMFTKWLQDVFNVPLIIQLTDD 454 +HRDLN IL+L+E G+KFYLYTGRGPSS+++HLGH+IPFMFTK+LQD F VPL+IQLTDD Sbjct: 78 AHRDLNEILDLYEKGEKFYLYTGRGPSSEALHLGHLIPFMFTKYLQDAFKVPLVIQLTDD 137 Query: 455 EKVLWRDIKVEDARKMAYNNAKDIIAIGFDPSNTFIFNDLDFIGQCPAFYQNMLRIQKCV 634 EK LW+++ VE+ +++A NAKDIIA GFD TFIF+D +++G AFY+NM+++ +CV Sbjct: 138 EKFLWKNLTVEETKRLARENAKDIIACGFDVERTFIFSDFNYVG--GAFYENMVKVARCV 195 Query: 635 TYNQVKGIFGFGDSDVIGKITFP 703 TYN+V GIFGF D IGK++FP Sbjct: 196 TYNKVVGIFGFTPEDHIGKVSFP 218 >07_01_1132 + 10531922-10532136,10532307-10532433,10532945-10533100, 10533755-10533847,10534010-10534090,10534205-10534276, 10534608-10534676,10534764-10534874,10535039-10535089 Length = 324 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 647 VKGIFGFGDSDVIGKITFP 703 +KGIFG D IGK++FP Sbjct: 115 LKGIFGISPEDQIGKVSFP 133 >06_03_0615 - 22761375-22761760,22762218-22765026 Length = 1064 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 23 LKITFYVKNLNNKMAEDKTINIAIAEDEDFVDPWTVT 133 L + + + N + +A K +++++A +DF PWT T Sbjct: 723 LVVVWILINRSRTLAGKKAMSMSVAGGDDFSHPWTFT 759 >02_05_0235 - 27068516-27069032,27069697-27069788,27070056-27070289, 27071569-27071676,27071796-27071855,27072368-27072443, 27072550-27072710,27076919-27076981,27077061-27077148, 27077568-27078308,27078406-27079033,27079314-27079368, 27082073-27083527 Length = 1425 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 152 IDYDKLIKRFGSQKIDDELIQRFEKVIGRKAHHLLR 259 + + +++ +GS+ +DD+L E V G H LL+ Sbjct: 997 LQHPNIVRYYGSEMVDDKLYIYLEYVSGGSIHKLLQ 1032 >07_01_0733 + 5570084-5570282,5570395-5570600,5572484-5572624, 5572773-5572949,5573049-5573145,5573575-5573687, 5573774-5573896,5574004-5574075,5575340-5575432, 5575564-5575674,5575767-5575889,5576834-5576890, 5576939-5577022,5577140-5577214,5577418-5577554, 5577719-5577853,5579029-5579168,5579334-5579399, 5579732-5579838,5579910-5579990,5580064-5580138, 5580224-5580325,5581837-5582005,5582090-5582217, 5582596-5582679,5582779-5582879,5583729-5583882, 5583964-5584038,5584112-5584262,5584463-5585078, 5585427-5585487,5585874-5586019,5586104-5586287, 5586363-5586440,5586603-5586931,5587023-5587199, 5587571-5587667,5587742-5587897,5587962-5588198, 5588271-5588354,5588426-5588486,5588762-5588898 Length = 1912 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = -3 Query: 703 WECNLANDIRITETEYALYLVVCDTFLYP*HVLVKSWALPNKIQIIKYKCI*RIKSNCY 527 W L +IR+ +TE L T L +K + +P KIQ + KC + + Y Sbjct: 1813 WSVYLDQEIRLGDTEIIRALFERVTCLSLPPKKMKIYLIPRKIQFVSEKCNPELSDSSY 1871 >04_04_0779 - 28023735-28024058,28024520-28024618,28024704-28024940, 28025227-28025334,28025427-28025486,28025813-28025888, 28025984-28026144,28026374-28026436,28026543-28026630, 28026872-28027612,28027695-28028239 Length = 833 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 152 IDYDKLIKRFGSQKIDDELIQRFEKVIGRKAHHLLR 259 + + +++ +GS+ +DD+L E V G H LL+ Sbjct: 466 LQHPNIVQYYGSETVDDKLYIYLEYVSGGSIHKLLQ 501 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,071,501 Number of Sequences: 37544 Number of extensions: 366089 Number of successful extensions: 734 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -