BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a17 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 26 1.0 AY842257-1|AAW29520.1| 92|Anopheles gambiae glutathione peroxi... 25 1.8 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 24 5.4 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 7.1 AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-tran... 23 7.1 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 23 9.4 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 23 9.4 AJ439061-1|CAD27770.1| 89|Anopheles gambiae hypothetical prote... 23 9.4 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 431 LIIQLTDDEKVLWRDIKVEDARKMAYNNAKDII 529 L +++ D K RD+ + AR++ +NN K II Sbjct: 27 LELEMNSDLKPQLRDLYITRAREVEFNNKKAII 59 >AY842257-1|AAW29520.1| 92|Anopheles gambiae glutathione peroxidase protein. Length = 92 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +2 Query: 176 RFGSQKIDDELIQRFE 223 +FGS++ DE++QRFE Sbjct: 25 QFGSKESPDEIVQRFE 40 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.8 bits (49), Expect = 5.4 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +2 Query: 221 EKVIGRKAHHLLRRGIFFSHRD 286 ++++ + HH RG++F+ RD Sbjct: 91 KQLLVKDFHHFPNRGVYFNERD 112 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.4 bits (48), Expect = 7.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 682 DIRITETEYALYLVVCDTFLYP*HVLVKSWAL 587 ++ +T++ +A+ + +CDTF P H L AL Sbjct: 61 ELTLTDS-HAILVYLCDTFAPPGHTLALPDAL 91 >AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-transferase D11 protein. Length = 214 Score = 23.4 bits (48), Expect = 7.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 506 KPFSLHLQLLYLSTVPSHHLSVE*LEVH*KHLV 408 K LHL L + + HL E L+++ +H V Sbjct: 20 KALGLHLNLKEVDLLKGEHLKPEFLKINPQHTV 52 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/29 (27%), Positives = 12/29 (41%) Frame = +1 Query: 583 WAVPSFLPEHVKDTEMCHIQPSKGHIRFR 669 W +P+F H D C P + +R Sbjct: 61 WYIPAFFAAHPTDRTGCPTDPDGWRLDYR 89 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/29 (27%), Positives = 12/29 (41%) Frame = +1 Query: 583 WAVPSFLPEHVKDTEMCHIQPSKGHIRFR 669 W +P+F H D C P + +R Sbjct: 61 WYIPAFFAAHPTDRTGCPTDPDGWRLDYR 89 >AJ439061-1|CAD27770.1| 89|Anopheles gambiae hypothetical protein protein. Length = 89 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/29 (27%), Positives = 12/29 (41%) Frame = +1 Query: 583 WAVPSFLPEHVKDTEMCHIQPSKGHIRFR 669 W +P+F H D C P + +R Sbjct: 61 WYIPAFFAAHPTDRTGCPTDPDGWRLDYR 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,784 Number of Sequences: 2352 Number of extensions: 14966 Number of successful extensions: 32 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -