BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a15 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 26 0.95 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 26 1.3 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 26.2 bits (55), Expect = 0.95 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 296 NGSQLSYKTPLNESLSKELRHFHTSHAVNKIV 391 NG++L Y+ LN S E FHT + ++ Sbjct: 4 NGNRLQYQQLLNVSFGDEFEVFHTQVSAQHVL 35 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 296 NGSQLSYKTPLNESLSKELRHFHT 367 NG++L Y+ LN S E FHT Sbjct: 4 NGNRLQYQQLLNVSFGDEFEVFHT 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,392 Number of Sequences: 2352 Number of extensions: 12200 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -