BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a15 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 2.7 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 6.1 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 260 CRKIKVTTQSARNGSQLSYKTPLNESLSKELRH 358 C+K +++ S R+ S+ +T S ++LRH Sbjct: 207 CKKYAISSNSLRSRSRSFQRTSSCHSRYEDLRH 239 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 6.1 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 455 KVGDNV-QQFDNICEVQSDKAAVTITSRYDGIITRLYHDIDQTALVGQPLVDIDVQDSEN 631 KV N ++F ++ + A +T+ T+ D+ L L D+D+ SEN Sbjct: 482 KVTSNYHEEFQSLNNAVGEMEATNVTNILSMDNTQYNLDLSLPQLDSTELADLDISLSEN 541 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,428 Number of Sequences: 438 Number of extensions: 3441 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -