BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a13 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 159 1e-39 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 108 5e-24 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 106 2e-23 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 100 1e-21 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 89 3e-18 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 9e-17 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 83 2e-16 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 83 3e-16 SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) 64 1e-10 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) 58 7e-09 SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) 58 9e-09 SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) 48 5e-06 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) 45 5e-05 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) 41 8e-04 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 40 0.002 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 40 0.002 SB_38537| Best HMM Match : VWA (HMM E-Value=0) 31 1.1 SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) 30 2.0 SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_26293| Best HMM Match : WD40 (HMM E-Value=1.1e-15) 29 3.5 SB_47019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 29 4.6 SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29) 28 6.1 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12) 28 8.0 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 159 bits (387), Expect = 1e-39 Identities = 78/130 (60%), Positives = 89/130 (68%) Frame = +2 Query: 284 NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 463 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 92 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 151 Query: 464 TDYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDD 643 +DYPFKPPK G +CLDIL+ WSPALTISKVLLSICSLL D NP D Sbjct: 152 SDYPFKPPK---------------GMVCLDILKDSWSPALTISKVLLSICSLLTDCNPAD 196 Query: 644 PLVPEIARIY 673 PLV IA +Y Sbjct: 197 PLVGSIAALY 206 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 108 bits (259), Expect = 5e-24 Identities = 50/96 (52%), Positives = 64/96 (66%), Gaps = 4/96 (4%) Frame = +2 Query: 401 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL----RAQ 568 ++G +PY G+F L I P YPF+PPKV F T IYHPNI+S+G ICLD L + Sbjct: 2 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGM 61 Query: 569 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 676 W PAL IS VL +I L+ +PNPDDPL+ EI+ +K Sbjct: 62 WKPALNISSVLSTILILMAEPNPDDPLMAEISNEFK 97 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 106 bits (254), Expect = 2e-23 Identities = 44/69 (63%), Positives = 52/69 (75%) Frame = +2 Query: 284 NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 463 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 132 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 191 Query: 464 TDYPFKPPK 490 +DYPFKPPK Sbjct: 192 SDYPFKPPK 200 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 100 bits (239), Expect = 1e-21 Identities = 43/103 (41%), Positives = 64/103 (62%), Gaps = 1/103 (0%) Frame = +2 Query: 377 DLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDI 556 ++ +WQ I+ P PY G F + I FP +YPFKPPK+ F T+IYHPNI+ G +CL I Sbjct: 22 NILYWQGLIV-PEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPI 80 Query: 557 LRAQ-WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 682 + + W PA +V+ ++ +L+ DP P+ PL ++A Y D Sbjct: 81 ISPENWKPATKTEQVIQALLALVHDPEPEHPLRADLAEEYSKD 123 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 89.0 bits (211), Expect = 3e-18 Identities = 41/72 (56%), Positives = 51/72 (70%), Gaps = 4/72 (5%) Frame = +2 Query: 473 PFKPPKVAFTTRIYHPNINSNGSICLDIL----RAQWSPALTISKVLLSICSLLCDPNPD 640 PF+PPKV F T IYHPNI+S+G ICLD L + W PAL IS VL +I L+ +PNPD Sbjct: 40 PFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPD 99 Query: 641 DPLVPEIARIYK 676 DPL+ EI+ +K Sbjct: 100 DPLMAEISNEFK 111 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 84.2 bits (199), Expect = 9e-17 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 14/121 (11%) Frame = +2 Query: 326 DLGRDPPAQCSAGPHG-EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 502 +L + P SAG EDL+ W+ ++GP + Y+ G F ++ FP +YP +PP + F Sbjct: 343 ELQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFI 402 Query: 503 TRIYHPNINSNGSICLDILR-------------AQWSPALTISKVLLSICSLLCDPNPDD 643 + I+HPN++ NG +C+ IL +W P T+ ++LS+ S+L +PN + Sbjct: 403 SDIWHPNVHKNGEVCISILHEPGEDKYGYEKADERWRPIHTVETIMLSVISMLAEPNDES 462 Query: 644 P 646 P Sbjct: 463 P 463 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 83.0 bits (196), Expect = 2e-16 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 14/131 (10%) Frame = +2 Query: 296 ALKRINRELQDLGRDPPAQCSAG-PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDY 472 A++ + EL+ L +P + P + F W I GP + Y GG F + FP DY Sbjct: 1125 AVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDY 1184 Query: 473 PFKPPKVAFTTRIYHPNINSNGSICLDILR-------------AQWSPALTISKVLLSIC 613 P+ PP F T+++HPNI +G +C+ IL +W+P + +LLS+ Sbjct: 1185 PYSPPTFRFLTKMWHPNIYESGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVI 1244 Query: 614 SLLCDPNPDDP 646 SLL +PN P Sbjct: 1245 SLLNEPNTFSP 1255 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 82.6 bits (195), Expect = 3e-16 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +2 Query: 356 SAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 511 SAGP G+ L+ W +TI+GP S Y+GGVFFL IHFPTDYPFKPPKV R+ Sbjct: 43 SAGPKGDKLYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPPKVGQAIRL 94 >SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) Length = 46 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 599 LLSICSLLCDPNPDDPLVPEIARIYKTD 682 LLSICSLLCDPNPDDPLVP+IARIYKTD Sbjct: 2 LLSICSLLCDPNPDDPLVPDIARIYKTD 29 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 62.9 bits (146), Expect = 2e-10 Identities = 42/128 (32%), Positives = 61/128 (47%) Frame = +2 Query: 287 SQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPT 466 S +K++ RE+ L DPP + ED+ QA+I GP FFLT Sbjct: 103 SPQIIKQVAREIHGLTNDPPEGIKVFSNDEDITDIQASIEGPR--------FFLT----- 149 Query: 467 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTISKVLLSICSLLCDPNPDDP 646 +I+HPN+ NG IC++ L+ W P L I +VLL++ LL PNP+ Sbjct: 150 -------------KIFHPNVAKNGEICVNTLKKDWKPDLGIKQVLLTVKCLLIVPNPESA 196 Query: 647 LVPEIARI 670 L E ++ Sbjct: 197 LNEEAGKL 204 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 5/70 (7%) Frame = +2 Query: 365 PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTR-----IYHPNIN 529 P +D+ A I GP D+PY+GG F+ I P DYP +PP+V T ++PN+ Sbjct: 5 PDKDDIPKIHALITGPFDTPYEGGFFYFLIRCPPDYPIRPPRVKLMTTGSGQVRFNPNLY 64 Query: 530 SNGSICLDIL 559 NG +CL I+ Sbjct: 65 RNGKVCLSII 74 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 61.3 bits (142), Expect = 7e-10 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 3/125 (2%) Frame = +2 Query: 257 VESQYNST*NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGG 436 +E QYN A+KR+ RE ++L R+ A P ++LF W T+ GP D+ + GG Sbjct: 1 MEKQYNLR---SPAVKRLMREAKEL-RNATELYHAQPLEDNLFEWHFTVRGPPDTEFAGG 56 Query: 437 VFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR---AQWSPALTISKVLLS 607 + I P +YP KPP + T + ICL + W P+ +I VL++ Sbjct: 57 RYHGRIILPPEYPMKPPSIMLLTP--NGRFEIGKKICLSMSAHHPETWQPSWSIRTVLMA 114 Query: 608 ICSLL 622 I + Sbjct: 115 IIGFM 119 >SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) Length = 215 Score = 58.0 bits (134), Expect = 7e-09 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%) Frame = +2 Query: 410 PVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNIN-SNGSICLDILRAQWSPALT 586 P D Y+GG F ++ DYP PP IYHPN++ +GS+CL +L W+ + Sbjct: 45 PTDGAYRGGQFKFSVK-TEDYPNTPPVPRCVNNIYHPNMDLDDGSVCLSLL-DDWNESND 102 Query: 587 ISKVLLSICSLLCDPNPDDPLVP 655 + ++ + L +PN +DPL P Sbjct: 103 LEDLVQGLLFLFYNPNLEDPLSP 125 >SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) Length = 243 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/80 (32%), Positives = 43/80 (53%) Frame = +2 Query: 410 PVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTI 589 P D Y+GG F ++ TDYP P + T+IYHPN++ +C+ +L W + + Sbjct: 45 PTDGAYRGGQFKFSVR-TTDYPNVAPSINCKTKIYHPNMDGYDGVCMSLL-DDWQASNDL 102 Query: 590 SKVLLSICSLLCDPNPDDPL 649 ++ + L +PN +DPL Sbjct: 103 EDLVQGLLFLFYNPNLEDPL 122 >SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) Length = 48 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = +2 Query: 566 QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 682 +WSPAL I VLLSI +LL PNPDDPL ++A +K + Sbjct: 2 KWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKVN 40 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 48.0 bits (109), Expect = 7e-06 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 10/111 (9%) Frame = +2 Query: 302 KRINRELQDLGRDPPAQCSAGPHGEDLFHWQA---TIMGPV----DSPYQGGVF-FLTIH 457 KR+ +E QD+ R SA ++LF W TI G D G F L I Sbjct: 737 KRLMKEFQDVSRKTERIFSAELVDDNLFEWNVKLHTIDGDSLLYRDMVETGSKFILLNIT 796 Query: 458 FPTDYPFKPPKV-AFTTRIYHPNINSNGSICLDILRAQ-WSPALTISKVLL 604 FP ++PF PP + RI + G+IC+++L + WS A T+ V+L Sbjct: 797 FPENFPFAPPFMRVLAPRIEGGFVLDGGAICMELLTPKGWSSAYTVEAVVL 847 >SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) Length = 123 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 374 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 505 ++LF W T+ GP D+ + GG + I P +YP KPP + T Sbjct: 1 DNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLT 44 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 407 GPVDSPYQGGVFFLTIHFPTDYPFKPPKVA-FTTRI 511 GPV +PY+GGV+ + + P YPFK P +A FT I Sbjct: 56 GPVGTPYEGGVWKVRVDLPEKYPFKSPSIANFTIEI 91 >SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) Length = 55 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +2 Query: 392 QATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 505 +A + GPVD+PY G F I FP YP PP V T Sbjct: 9 RALVTGPVDTPYSRGCFVFDIFFPGTYPNVPPLVKLIT 46 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 401 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPK 490 I GP ++P++GG + L I P YPF PPK Sbjct: 693 IRGPPETPFEGGTYNLDIVIPETYPFNPPK 722 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +2 Query: 389 WQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI---YHPNINSNGSICL 550 ++ I GP +PY G+F I P +YP PP + + +PN+ +G +C+ Sbjct: 636 FRVMIEGPAGTPYDHGLFAFDILLPANYPDAPPSFHYLSMCNGRLNPNLYEDGKVCI 692 >SB_38537| Best HMM Match : VWA (HMM E-Value=0) Length = 1174 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 17 CCSPFAEKCLISINSCFVPIIISFVL 94 C A+KC+ + +CFVPI ++F++ Sbjct: 507 CLRGCAKKCVPKVKTCFVPIDVAFIM 532 >SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 425 YQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNG 538 ++ ++ L I +YP KPP V F ++I +NS G Sbjct: 3 FENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKG 40 >SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 425 YQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNG 538 ++ ++ L I +YP KPP V F ++I +NS G Sbjct: 3 FENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKG 40 >SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) Length = 577 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 650 PKGRLGWDRIEVSRLRATLWIW*ALVTTVHAECQDRW 540 P RL W+R+E+SR+ LW W V + Q W Sbjct: 166 PLFRLHWNRVEMSRVMVFLW-WIKFALRVSMQKQINW 201 >SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 470 YPFKPPKVAFTTRIYHPNINSNG 538 +P P V FT+ ++HP I+ NG Sbjct: 118 FPDSRPLVKFTSNVFHPQIHENG 140 >SB_26293| Best HMM Match : WD40 (HMM E-Value=1.1e-15) Length = 140 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 445 EENSSLIRTVNWAHNCGLPMEQIFTV-WACRTLCW 344 E +S +R V WA N GLP I + CR + W Sbjct: 35 EAHSDWVRDVAWAPNVGLPTSTIASCSQDCRVIIW 69 >SB_47019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +2 Query: 311 NRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSP--YQGGVFFLTIHFPTDYPFKP 484 ++E++++ + PP G G + W + +DS + G+ + TD F+ Sbjct: 89 DKEIENIRKPPPPLVPLGRQGTECKTWLRMQLHDIDSDVRMRSGLRMKGTYNDTDIDFEE 148 Query: 485 PKVAFTTRIY 514 A TTR+Y Sbjct: 149 ISKAETTRLY 158 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 374 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYP 475 E+ F W + ++ VDS + GGV+ L + P P Sbjct: 186 EESFQWMSHVLPAVDSIHSGGVYCLCLVPPGGLP 219 >SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29) Length = 1239 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 572 SPALTISKVLLSICSLLCDPNPD--DPLVPEIARIYK 676 S +LTISK + IC LL DPN + + + IY+ Sbjct: 116 SSSLTISKFVPHICKLLGDPNSQVRERAIDTLVEIYR 152 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 423 GLSTGPIIVACQWNRSS-PCGPAEHCAGGSLPRSCNS 316 GL + A WN S C P A GSL +CNS Sbjct: 803 GLRCDQCVSAYYWNPSGYGCSPCNCDASGSLATNCNS 839 >SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12) Length = 186 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 339 IHQHNVRQAHTVKICSIGKPQLWAQLTVLIKE 434 +H+ N + +++C QLW L VLIK+ Sbjct: 56 LHRENYHDSERIQVCKGRIIQLWELLLVLIKQ 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,692,037 Number of Sequences: 59808 Number of extensions: 502336 Number of successful extensions: 1161 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -