BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a10 (704 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64842-1|AAB37083.2| 710|Caenorhabditis elegans Hypothetical pr... 33 0.20 U28738-2|AAA68309.4| 982|Caenorhabditis elegans Hypothetical pr... 27 9.9 >U64842-1|AAB37083.2| 710|Caenorhabditis elegans Hypothetical protein F25B4.5 protein. Length = 710 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -3 Query: 498 KILFDSAVVGCSI*KFFWNV*QLRWQWC*TRSMDQFRVIKFKA 370 KILFD ++ CS+ + FW + RW W +S + R I KA Sbjct: 404 KILFDRCLIPCSLYEEFW-IKYARWTWKTYKSKTKSREIYMKA 445 >U28738-2|AAA68309.4| 982|Caenorhabditis elegans Hypothetical protein T28D9.7 protein. Length = 982 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 657 QAASCHDDHTPSDLIIAHYFYN 592 Q S HDDH P D HY+YN Sbjct: 876 QPPSYHDDHHPED----HYYYN 893 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,775,576 Number of Sequences: 27780 Number of extensions: 286681 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -