BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a06 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 29 0.12 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 25 3.3 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 24 4.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.8 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 5.8 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 29.5 bits (63), Expect = 0.12 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 119 PRRVKTSVPCALARKASVTRAPFSIVSSPISCCKEGTSPTITALGESPSTAIS 277 P ++K S+P K S T P+S P C G T G+S S +S Sbjct: 307 PIKLKLSLPYVEREKCSKTFRPWSFALGPGQMCAGGERAKDTCAGDSGSPLMS 359 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 212 CCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPW 331 CC S T+L ESP+ + L R+ + PW Sbjct: 82 CCAGVRSKGKTSLPESPNCGVQLTDRVLGGQPTKIDEFPW 121 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 24.2 bits (50), Expect = 4.4 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 354 WFPVLHHHCQD 386 W+P + HHC D Sbjct: 100 WYPEIKHHCPD 110 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 388 SWLDGRHVVFGNVVEGMEVVKQIETFGSQSGKTSK 492 SWL HV V E +V+ +GS S +T+K Sbjct: 3198 SWLLLAHVAPAAVREVKRIVQNFFGWGSSSSRTTK 3232 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = +2 Query: 212 CCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPW 331 CC ++ SP I + RI T +L PW Sbjct: 77 CCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTELEEFPW 116 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 835,247 Number of Sequences: 2352 Number of extensions: 18546 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -