BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a03 (390 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37831| Best HMM Match : MAM (HMM E-Value=0) 30 0.58 SB_8910| Best HMM Match : MAM (HMM E-Value=1.9) 30 0.58 SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 28 3.1 SB_45686| Best HMM Match : T-box (HMM E-Value=0) 27 4.1 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 27 4.1 SB_39907| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 >SB_37831| Best HMM Match : MAM (HMM E-Value=0) Length = 563 Score = 30.3 bits (65), Expect = 0.58 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 95 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 205 G G + Q QV + + GET + ++ V+G GDI Sbjct: 151 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 187 >SB_8910| Best HMM Match : MAM (HMM E-Value=1.9) Length = 89 Score = 30.3 bits (65), Expect = 0.58 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 95 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 205 G G + Q QV + + GET + ++ V+G GDI Sbjct: 22 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 58 >SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 8 GARVLIVLSSILQAKMDKPNVLARVVKVLGRTGSQGQC 121 GAR + V ++ + VLAR + L R G++G+C Sbjct: 597 GARAVCVAGALSARSLSGHAVLARSARALTRLGARGRC 634 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 28.3 bits (60), Expect = 2.4 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 7 WCTCVNC-IKLDITSQN--G*TQRSCSCRESTRPYWFSG 114 WC C NC +KL I+ + R C+ + R WF G Sbjct: 2446 WCECSNCSLKLFISHKERMPMMHRVCNMQRKIRTSWFGG 2484 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = +2 Query: 17 VLIVLSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGP 187 V++VL ++ A + P + R+ + R Q + +KVE + ET ++ ++GP Sbjct: 641 VMLVLIELMPAVV-MPMMYTRIFLTVRRHNRLDQKSGIKVELVDETFTKLKGEIRGP 696 >SB_45686| Best HMM Match : T-box (HMM E-Value=0) Length = 947 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -3 Query: 241 PPSFTFRFKKSEDVSVTDRSFHVPDDLTAGLPNELD 134 P S RFK SED T +SF D G P ELD Sbjct: 568 PSSSPKRFKTSEDEEPTAQSFE--SDEIPGSPEELD 601 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -3 Query: 235 SFTFRFKKSEDVSVTDRSFHVPDDLTAGL----PNELDLHLSTLALRTSTAEYFHDTSKN 68 +FT ++++ +S+TD F V +++ G +EL L T+A T EY K Sbjct: 373 AFTLELRQTKSLSLTDEQFPVDEEMQRGCVRTPVSELTLEARTIAQDTD-LEYLKQLKKT 431 Query: 67 V 65 + Sbjct: 432 L 432 >SB_39907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 99 RPSTFTTRARTLGLSILACNIELNTINTRAPK 4 RPS ART L L+TINTR+P+ Sbjct: 548 RPSGLAIGARTRPKRHLPLGTSLSTINTRSPR 579 >SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 67 RSCSCRESTRPY-WFSGPVYSSEGRVHWGDQPSD 165 R + E R + WF GP + EG W + SD Sbjct: 1623 RGLNIEELNREHRWFRGPDFLEEGESEWPKKRSD 1656 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,664,669 Number of Sequences: 59808 Number of extensions: 216051 Number of successful extensions: 532 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 681761575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -