BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10a01 (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.4 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 2.4 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +1 Query: 397 SPKSNIPLRVLSRAVVIFSLLIIVYFTSNDGAFKIFAKQNEVISG 531 +P+S RVL F+++I+ +T+N AF + + ++G Sbjct: 630 TPRS-FSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTG 673 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 127 IGENLHNYSSLNSFFYARE 71 +GENLHN+ S F E Sbjct: 355 VGENLHNHQSFGMDFSLNE 373 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,398 Number of Sequences: 438 Number of extensions: 3052 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -