Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc9j01
         (324 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    25   0.15 
L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protei...    19   9.9  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    19   9.9  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 25.4 bits (53), Expect = 0.15
 Identities = 9/37 (24%), Positives = 14/37 (37%)
 Frame = -3

Query: 115  WWRLLASQKWWWQCWQRGAALSGSHVTPRASSPTSTS 5
            WW    +  WW     R    +    T   + PT+T+
Sbjct: 1042 WWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTN 1078


>L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protein
          protein.
          Length = 74

 Score = 19.4 bits (38), Expect = 9.9
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = +3

Query: 66 RCQHCHHHF 92
          RC+HC   F
Sbjct: 39 RCEHCDRQF 47


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 19.4 bits (38), Expect = 9.9
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = +3

Query: 66  RCQHCHHHF 92
           RC+HC   F
Sbjct: 192 RCEHCDRQF 200


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,011
Number of Sequences: 336
Number of extensions: 639
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 49
effective length of database: 106,121
effective search space used:  6155018
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)