Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc8o03
         (236 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5B433 Cluster: Palmitoyltransferase pfa5; n=3; Trichoc...    31   3.8  

>UniRef50_Q5B433 Cluster: Palmitoyltransferase pfa5; n=3;
           Trichocomaceae|Rep: Palmitoyltransferase pfa5 -
           Emericella nidulans (Aspergillus nidulans)
          Length = 474

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -1

Query: 170 PFRSRGCRRLDRSGRKIVQDCPFAGRTEQESSGMLIVQ 57
           P R+  CR +DR  RK+   CP+ G    E+S    +Q
Sbjct: 182 PDRTHHCREVDRCVRKMDHFCPWVGGVVSETSFKFFIQ 219


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 221,903,735
Number of Sequences: 1657284
Number of extensions: 3459590
Number of successful extensions: 8586
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8445
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8585
length of database: 575,637,011
effective HSP length: 57
effective length of database: 481,171,823
effective search space used: 10104608283
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)