BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmnc8n08
(235 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE013599-1890|AAF58250.1| 504|Drosophila melanogaster CG8422-PA... 26 8.1
>AE013599-1890|AAF58250.1| 504|Drosophila melanogaster CG8422-PA
protein.
Length = 504
Score = 25.8 bits (54), Expect = 8.1
Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Frame = -2
Query: 183 FRLCKCFKSTL--KLSFSQLTGTATTILLLSVKISKMAVINCSQ*LITL 43
F+ +C ++T+ L F+ + ILLLSV+IS + + LITL
Sbjct: 154 FKELRCLRNTIHANLFFTYIMSALFWILLLSVQISIRSGVGSCIALITL 202
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,401,435
Number of Sequences: 53049
Number of extensions: 170799
Number of successful extensions: 383
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 381
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 383
length of database: 24,988,368
effective HSP length: 57
effective length of database: 21,964,575
effective search space used: 439291500
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -