SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc8l20
         (686 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic acetylch...    25   2.2  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    24   3.9  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    24   3.9  
EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    23   6.8  

>AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 1 protein.
          Length = 557

 Score = 25.0 bits (52), Expect = 2.2
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = +1

Query: 301 EKHTLCRGIV---TIYFIAIITMFLCLSSTVPKTRRIRMLAMVVLTLT 435
           EK +LC  I+   T++F+ +  +    S TVP   +  +  M+++TL+
Sbjct: 269 EKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLS 316


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 24.2 bits (50), Expect = 3.9
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 366  KEHCNNCNEIYC 331
            K HC +C +I+C
Sbjct: 1824 KHHCRSCGQIFC 1835


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 24.2 bits (50), Expect = 3.9
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 366  KEHCNNCNEIYC 331
            K HC +C +I+C
Sbjct: 1825 KHHCRSCGQIFC 1836


>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
           channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 23.4 bits (48), Expect = 6.8
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -2

Query: 670 KYKWMPTTELEYDAVNNSFNTLN 602
           KY  +  TE+E   V+N  NT+N
Sbjct: 568 KYNSVDLTEVELPEVDNPSNTIN 590


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 588,238
Number of Sequences: 2352
Number of extensions: 11649
Number of successful extensions: 33
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 69413730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -